hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Dot NET Full Stack Expert with Azure

10.00 to 12.00 Years   Bangalore   04 Sep, 2021
Job LocationBangalore
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaGeneral / Other Software,Web / Mobile Technologies
EmploymentTypeFull-time

Job Description

This is an opportunity to work onsite at our customer s location at Schneider-Electric, Bangalore. They are pioneers in IoT/IIoT with their state-of-the-art technologies with connected devices, next generation Schneider-Electric cloud platform, analytics, and services.

In this job, you will be part of our EcoStruXure Innovation Journey, contributing in developing core software applications, frameworks, and foundation technologies for next generation Industrial Automation Landscape. You will be working on Schneider-Electric s offer ecosystem on Cloud, Web, PC and Mobile.

Technical Skill Set:
  • Design: Well versed with Design patterns, Good experience in design development of desktop, web and cloud native applications
  • App Development: C#, Web API, WPF, ASP.NET, .NET Core, Entity Framework (EF), PowerShell script, Bootstrap, HTML5, Typescript/JS, Node JS, Angular 2+
  • Database: One or more of : MS SQL, Document DB, RDF DB, Data Lake
  • Cloud: Azure (SAAS, PAAS, IAAS and Development), Containers/Docker
  • Source Control Mgmt.: GitHub, Azure Devops, Git/SVN, Jenkins / CICD
Other Competencies
  • Experience in Design Development of enterprise scale applications
  • Cyber Security, Threat Modelling, Secure development
  • Translating Business / Product requirements to Engineering Requirements
  • System level functional level Architecture and Design
  • Ability to Influence/Convince on right technology choice and solution approaches
  • Experience or Knowledge about Industrial Automation Domain is a big plus
,

Keyskills :
ms sqlcyber securitydesign patternsentity frameworkconnected devicesdesign developmentproduct requirementsindustrial automationsqlwpfapigitnetiaaspaaslakehtml5cloudazure

Dot NET Full Stack Expert with Azure Related Jobs

© 2019 Hireejobs All Rights Reserved