hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Technial engineer

3.00 to 5.00 Years   Delhi   25 Oct, 2021
Job LocationDelhi
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaGeneral / Other Software
EmploymentTypeFull-time

Job Description

BE IT/ Diploma in IT or Engineering Field. Professional certifications like MCSE, VMware, RHCE etc. will be a definite plus.Experience: 3 to 5 YearsPre-Requisites: Good Communication Skills Oral and Written, Problem solving attitude and Ability to handle customer situations.Domain expertise (any 2) Microsoft Solutions AD/ Exchange/ OS365/ MS SQL, Virtualization, IT Security AV/ AS/ DLP/ SIEM, Firewall, Backup and Storage.Roles Responsibilities: Technical Support Engineer is responsible for providing technical support services to customers on assigned products and solutions from TecPact.This is a customer facing role and require daily visits to customer places as per the requirement.Installation, Configuring and troubleshooting at the customer premises WIN/ Linux Environment.Firewall Management Installation, Configuration, Management, Policy Setting etc.Infrastructure Assessment Server Utilization, Application requirement, Storage Architecture, Virtualization models etc.Ability to Independently monitor, network, systems, Internet, WAN, wireless, VPN security etc.Analyze technical problems respond to the customer complaints by taking remote, field visit or on a tele call.Maintaining a log of all support issues and their status and Report to customer and Manager.,

Keyskills :
ms sqlit securityproblem solvingcustomer complaintsfirewall managementmicrosoft solutionscommunication skillssqlwanvpnmcserhcesiemlinuxsuppt servicestechnical suppage architecturevisi

Technial engineer Related Jobs

© 2019 Hireejobs All Rights Reserved