Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Delhi |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | IT - Software |
Functional Area | General / Other Software |
EmploymentType | Full-time |
BE IT/ Diploma in IT or Engineering Field. Professional certifications like MCSE, VMware, RHCE etc. will be a definite plus.Experience: 3 to 5 YearsPre-Requisites: Good Communication Skills Oral and Written, Problem solving attitude and Ability to handle customer situations.Domain expertise (any 2) Microsoft Solutions AD/ Exchange/ OS365/ MS SQL, Virtualization, IT Security AV/ AS/ DLP/ SIEM, Firewall, Backup and Storage.Roles Responsibilities: Technical Support Engineer is responsible for providing technical support services to customers on assigned products and solutions from TecPact.This is a customer facing role and require daily visits to customer places as per the requirement.Installation, Configuring and troubleshooting at the customer premises WIN/ Linux Environment.Firewall Management Installation, Configuration, Management, Policy Setting etc.Infrastructure Assessment Server Utilization, Application requirement, Storage Architecture, Virtualization models etc.Ability to Independently monitor, network, systems, Internet, WAN, wireless, VPN security etc.Analyze technical problems respond to the customer complaints by taking remote, field visit or on a tele call.Maintaining a log of all support issues and their status and Report to customer and Manager.,
Keyskills :
ms sqlit securityproblem solvingcustomer complaintsfirewall managementmicrosoft solutionscommunication skillssqlwanvpnmcserhcesiemlinuxsuppt servicestechnical suppage architecturevisi