Chief Engineer

Job Description

Eaton India Innovation Centre: Eaton India Innovation Center (EIIC) in Pune, is an integral part of Eaton s global engineering and technology footprint and house one third of Eaton s intellectual horsepower with 2000 Engineers. EIIC is home for complete product design life cycle management, from research and technology efforts to product development &launches to product sustaining engineering activities. It has seven centers of excellence collaborate to leverage our size, scale and knowledge and harness the power of One Eaton for all of your power management solutions. Through proven technical excellence, EIIC continues to augment Eaton s leadership in improving existing products and services and developing new offerings. EIIC operates through its two state-of-the-art campuses located at Kharadi and Magarpatta City along with a world class 70000 Sq ft lab in Pune. Today, EIIC s current research and technology efforts are focused on global trends that are driving our future including: energy systems, intelligent machines, advanced materials and additive manufacturing. EIIC is focused on augmenting Eaton s vision of improving the quality of life and environment through the use of intelligent power management technologies and services .This position will be part of Regional & New spaces team in EIIC. The incumbent will be responsible to work closely with regional leader and propel the electrification strategy for Vehicle, eMobility & Aerospace. expectation is to understand the market demand and truly innovate Power Electronics solutions for the Regional customers. As a member of the engineering team, s/he will lead development of Power Electronics and will be required to work with Regional cross functional teams, interact with customers, Develop Supplier base, build within capability & also contribute to technology road map, while creating an echo system in the country for Power electronics.1. Lead Electrification growth (power electronics being the core) both in regional markets and new product spaces for Eaton. Number of pursuits, active technology creation, customer engagements, resultant growth in revenue through winning those opportunities will be measures. 2. Build cross functional engagement in-region for electrification products - number of technonology partner developed, translatable manufacturing/capital investment, supply base improvement to execute new product and technology 3. SME/Chief role for globally high impact e-Mobility programs and demonstrated owner at early concept/architecture building stages (Eatons product approval gate 1 & 2) covering technonology readiness, commercial readiness and manufacturability aspects. 4. Build technology career path for individuals in the area of power electronics domain. Demonstrate skill shift in vechicle organization for electrification, number of staff engineer creation, demonstrable thought leadership in the area through customer advocacy, publications, tech-forward proposals internally and externally including goverment organizations.QualificationsMinimum education for this position is a Masters in Electrical / Automotive/Aerospace Engineering, with experience in leading an interdisciplinary program and/or team. PhD in Power Electronics & Drives would be preferableMinimum 18 years ( with Masters) of industrial experience in multinational engineering organization with experience in regional leadership role.Expertise in technology in areas of mobility (Vehicle & Aerospace) Expertise in Power electronics to drive electrification Power electronics applications in multiple industries, especially on drives, hands on experience of product design System architecture of power electronics products. Power electronics topologies like AC/DC, DC/DC, DC/AC, AC/AC, familiar with the designs, trade-offs and control strategies. Components of power-electronic systems (e.g. semiconductors, gate drives, bulk capacitors, inductors, transformers, bus-bars, heat-sinks, current sensor technologies, voltage sensor technologies, etc.) Thermal solutions of power electronic components and how they relate to the design, packaging and lifetime of power electronic systems. Power electronics modeling & simulation tools (MATLAB Simulink, pSPICE, etc.) Hardware -in- Loop platforms and tools such as dSPACE, OPAL-RT, LabVIEW, RTDS, etc. Familiar with DSPs, MCUs and FPGAs and associated software and firmware development Familiar with the design and analysis of magnetic components for power electronics circuits such as high-frequency inductors and transformers and an extensive knowledge of the materials and construction techniques and how they affect their characteristics. Familiar with EMI/EMC analysis and filter design Thorough understanding of Functional Safety processes and linking high level Safety Goals with TSRs (Technical Safety Requirements). Knowledge of regulatory, certification & validation standards in Automotive industry,

Keyskills :
mechanicalsafetymachineryhvacplumbingboard of directorssupply chain managementcontinuous improvement facilitationlife cyclesupply chainhuman rightssalesmarketing