hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Quality Assurance Engineering, Specialist

5.00 to 7.00 Years   Pune   02 Aug, 2021
Job LocationPune
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaGeneral / Other Software,Quality (QA-QC)
EmploymentTypeFull-time

Job Description

  • 5-7 years of experience in software testing.
  • Experience of handling a team of 3 5 members
  • Basic SQL & Product Installation knowledge
  • Experience in Automation (C#, .NET and Selenium) Required Skills
  • Hands-on in API/Web services testing
  • Good knowledge of SDLC and QA practices and Hands-on exposure
  • Exposure to Online Banking Domain
  • Hands-on in functional, regression, Automation Testing
  • Exposure to QA tools (Bug Tracking, Test Management, Script Management, etc)
  • Experience on creating test cases, test scripts and execute them
  • Exposure to Metrics (Defect, Test Execution), status reports and exit reports)
  • Participate in all design reviews, test case reviews, interaction with BU, clients and stakeholders
Education:
  • Bachelor s degree in Computer Science or related discipline preferred.
Certification (Desired):ISTQB Advanced,

Keyskills :
qa toolstest casestest scriptsonline bankingtest managementcomputer scienceautomation testingsqlnetsdlcdesignbankingtestingmetricsscriptsreviewssoftwaremanagement

Quality Assurance Engineering, Specialist Related Jobs

© 2019 Hireejobs All Rights Reserved