Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
About the opportunity Key Responsibilities
people advisory, people and change, organisation and change, people and organisation, hr consulting, change management, organization design, Talent Strategy People Programs , People Advisory Servi...
continuousimprovementfacilitation hrconsulting riskmanagement clienthandling humanresources servicedelivery clientsolutions equipmentsupply changemanagement seniormanagement talentmanagement hrtransformation managementskills peopleleadershipAnalyst - Analytics Solutions - LitMass Analyst Analytics Solutions Job Title: Analyst Analytics Solutions Description of the Role One is expected to demonstrate a high level of technical experti...
datamining datascience datamanagement datastructures problemsolving clientsolutions equipmentsupply visualanalytics commercialmodels predictivemodeling positionmanagement compatibilitytesting ndustria
Client & User Support, Global Client Solutions
Client & User Support is an industry-leading and award-winning client service team starting in Hyderabad,
focusing on peopl...
Description We are seeking a talented and dynamic design leader in Bangalore for one of our key client in Interior design. Are you excited about reshaping the future of workplace design, creating ex...
research design leadership marketing sampling usinessdevelopment interiordesign projectmanagers workplacedesign presentationskills clientsolutions designleadership adobephotoshop
people advisory, people and change, organisation and change, people and organisation, hr consulting, change management, organization design, Talent Strategy People Programs , People Advisory Servi...
continuousimprovementfacilitation hrconsulting riskmanagement clienthandling humanresources servicedelivery clientsolutions equipmentsupply changemanagement seniormanagement talentmanagement hrtransformation managementskills peopleleadershipMicrosoft Dynamics Technical Consultant Talent Anywhere is a technology and execution company that implements turnkey projects to help companies establish and manage tech, process, sales and manufact...
sql sales customerrelations plsql continuousimprovementfacilitation fieldservice customerservice clientsolutions turnkeyprojects medicalinsurance microsoftdynamics employeeengagement ms developmentw
TechO2 is hiring skilled Sr. Software Engineers to work on some awesome client solutions.
Location: Hyderabad, India
Requirements:
RAMOJI FILM CITY, HYDERABAD 8 YEARS - 12 YEARS Read Regional Sales Lead Solid grasp of digital media, including various pricing models, targeting technologies and ad serving. Knowledge of programmatic...
sales marketing businessdevelopment accounts target adoperations digitalmedia regionalsales clientsolutions equipmentsupply presentationskills film video grasp ideal retail business campaigns operations onsult
people advisory, people and change, organisation and change, people and organisation, hr consulting, change management, organization design, Talent Strategy People Programs , People Advisory Servi...
continuousimprovementfacilitation hrconsulting riskmanagement clienthandling humanresources servicedelivery clientsolutions equipmentsupply changemanagement seniormanagement talentmanagement hrtransformation managementskills peopleleadershipIndependently generate enquiries, prepare estimations, provide value engineering solutions, negotiate with suppliers, meet consultant/ client for technical and commercial negotiations, prepare detaile...
sales commercial engineering marketanalysis ts valueengineering is analysis profiles suppliers enquiries engineers clientsolutions analysisrep commercialnegotiationsPOSITION SDM Transitions LOCATION Hyderabad REPORTING STRUCTURE Reporting to General Manager Transitions EXPECTED QUALIFICATION DETAILS Graduate / Post Gradu...
msoffice msproject largegroups duediligence microsoftexcel planningskills technicalskills clientsolutions seniormanagement analyticalskills microsoftproject projectmanagement cinsuranceCloud Assert is looking for a talented hands- on Cloud Architect to build exceptional client solutions using the Google Cloud Platform. The Role: The Google Cloud Architect will use Google Cloud P...
aws linux troubleshooting unix adobestreamline cloudcomputing computerscience machinelearning clientsolutions naturallanguage thoughtleadership arc tatementsofw ksow googlecloudplatf cloudst ageAnalyst - Analytics Solutions - LitMass Analyst Analytics Solutions Job Title: Analyst Analytics Solutions Description of the Role One is expected to demonstrate a high level of technical experti...
datamining datascience datamanagement datastructures problemsolving clientsolutions equipmentsupply visualanalytics commercialmodels predictivemodeling positionmanagement compatibilitytesting ndustria
The Senior Analytics Consultant role will require you to play a crucial role in fostering effective sales and client engagement whilst simultaneously managing the support, development and de...
teradata sas tableau abinitio algorithms dataquality marketresearch computerskills strategicsales clientsolutions customerinsight clientengagement knowledgesharing productmanagement advancedanalytics negotiationskills operationsresearchRAMOJI FILM CITY, HYDERABAD 8 YEARS - 12 YEARS Read Regional Sales Lead Solid grasp of digital media, including various pricing models, targeting technologies and ad serving. Knowledge of programmatic...
sales marketing businessdevelopment accounts target adoperations digitalmedia regionalsales clientsolutions equipmentsupply presentationskills film video grasp ideal retail business campaigns operations onsultLocation: Goregaon West - Mumbai Exp.: 1-2 years Job Description - Very good at building relationships with clients and within the office. - Youre passionate about relationships and are sophistica...
msofficetools clientsolutions governmentacquisition msoffice projectcharter excel strategy powerpoint dawia word pws marketing cpsr sourceselection sow steps milestones communication branding deliverables business statements identIndependently generate enquiries, prepare estimations, provide value engineering solutions, negotiate with suppliers, meet consultant/ client for technical and commercial negotiations, prepare detaile...
sales commercial engineering marketanalysis ts valueengineering is analysis profiles suppliers enquiries engineers clientsolutions analysisrep commercialnegotiationsMicrosoft Dynamics Technical Consultant Talent Anywhere is a technology and execution company that implements turnkey projects to help companies establish and manage tech, process, sales and manufact...
sql sales customerrelations plsql continuousimprovementfacilitation fieldservice customerservice clientsolutions turnkeyprojects medicalinsurance microsoftdynamics employeeengagement ms developmentwPurpose of your role The role of the Internal Audit Senior Manager is to lead/deliver/execute audit assignments as part of a wider team, to verify that business operations are effectively controlled ...
mis sales finance accountancy uildstrongrelationships reportwriting auditreports internalaudit projectmanagement internalcontrols workeffectively problemsolving businessunits clientsolutionsCloud Assert is looking for a talented hands- on Cloud Architect to build exceptional client solutions using the Google Cloud Platform. The Role: The Google Cloud Architect will use Google Cloud P...
aws linux troubleshooting unix adobestreamline cloudcomputing computerscience machinelearning clientsolutions naturallanguage thoughtleadership arc tatementsofw ksow googlecloudplatf cloudst ageIndependently generate enquiries, prepare estimations, provide value engineering solutions, negotiate with suppliers, meet consultant/ client for technical and commercial negotiations, prepare detaile...
sales commercial engineering marketanalysis ts valueengineering is analysis profiles suppliers enquiries engineers clientsolutions analysisrep commercialnegotiationsClient & User Support, Global Client Solutions Client & User Support is an industry- leading and award- winning client service team starting in Hyderabad, focusing on people with a specialized kno...
sales set excel reativesolutions clientservice interpersonalskills clientsolutions productdevelopment financialmarkets microsoftexcel collaborativeenvironmentAbout the opportunity Key Responsibilities Work closely with the Business Analysts/ Stakeholders to understand the requirements and define performance testing approach, plans and timelines. Able to wo...
rdp hp qa oftwaredevelopmentlifecycle performancetuning workingexperience performancetesting mutualfunds productverification clientsolutions webservices clientservice newrelic thirdpartyproducts functionalspecifications softwaredevelopmentMicrosoft Dynamics Technical Consultant Talent Anywhere is a technology and execution company that implements turnkey projects to help companies establish and manage tech, process, sales and manufact...
sql sales customerrelations plsql continuousimprovementfacilitation fieldservice customerservice clientsolutions turnkeyprojects medicalinsurance microsoftdynamics employeeengagement ms developmentw
Roles and Responsibilities
Responsible for thought leadership, sales and execution of projects across entire value chain of Human resources advisory. Lead global, regio...
Roles and Responsibilities
Responsible for thought leadership, sales and execution of projects across entire value chain of Human resources advisory. Lead global, regio...
Associate Domain Consultant - CPG Job ID: ADCPG || Location: Bangalore, India Engage with marketing clients and help them succeed. Manage day-to-day delivery independently along with analyst teams. ...
delivery accounting analytics automation dataanalysis consumergoods teammanagement clientsolutions businessplanning marketingresearch marketinganalytics businessadministration ep ting categ ymanagement
people advisory, people and change, organisation and change, people and organisation, hr consulting, change management, organization design, Talent Strategy People Programs , People Advisory Servi...
continuousimprovementfacilitation hrconsulting riskmanagement clienthandling humanresources servicedelivery clientsolutions equipmentsupply changemanagement seniormanagement talentmanagement hrtransformation managementskills peopleleadershipRAMOJI FILM CITY, HYDERABAD 8 YEARS - 12 YEARS Read Regional Sales Lead Solid grasp of digital media, including various pricing models, targeting technologies and ad serving. Knowledge of programmatic...
sales marketing businessdevelopment accounts target adoperations digitalmedia regionalsales clientsolutions equipmentsupply presentationskills film video grasp ideal retail business campaigns operations onsultManage relationships with client companies, making sure that requests are being met and that clients are satisfied with the level of service. Monitor day-to-day management of team members and actively...
generalledger riskmanagement servicedelivery clientsolutions problemresolution egulat yfilingsThe CTS Engineering Manager in Hyderabad will be responsible for establishing CTS Engineering from the ground up. The CTS business unit is looking for the right technologist to build a high performing...
safety commissioning preventivemaintenance iso documentation computerscience qualityassurance rugfreew kplace trustedbusinesspartner object ientedprogramming musicmaking clientsolutions longtermvisionDescription We are seeking a talented and dynamic design leader in Bangalore for one of our key client in Interior design. Are you excited about reshaping the future of workplace design, creating ex...
research design leadership marketing sampling usinessdevelopment interiordesign projectmanagers workplacedesign presentationskills clientsolutions designleadership adobephotoshopRAMOJI FILM CITY, HYDERABAD 8 YEARS - 12 YEARS Read Regional Sales Lead Solid grasp of digital media, including various pricing models, targeting technologies and ad serving. Knowledge of programmatic...
sales marketing businessdevelopment accounts target adoperations digitalmedia regionalsales clientsolutions equipmentsupply presentationskills film video grasp ideal retail business campaigns operations onsult Project Description
Fenergo is a leading provider of Client Lifecycle Management, AML/KYC Compliance and Client Data Management solutions for investment, corporate, commercial and privat...
Cloud Assert is looking for a talented hands- on Cloud Architect to build exceptional client solutions using the Google Cloud Platform. The Role: The Google Cloud Architect will use Google Cloud P...
aws linux troubleshooting unix adobestreamline cloudcomputing computerscience machinelearning clientsolutions naturallanguage thoughtleadership arc tatementsofw ksow googlecloudplatf cloudst ageIndependently generate enquiries, prepare estimations, provide value engineering solutions, negotiate with suppliers, meet consultant/ client for technical and commercial negotiations, prepare detaile...
salescommercialengineeringmarketanalysisvalueengineeringanalysisprofilessuppliersenquiriesengineersclientsolutionsanalysisrepcommercialnegotiationsManage relationships with client companies, making sure that requests are being met and that clients are satisfied with the level of service. Monitor day- to- day management of team members and active...
financeriskbankingcompliancegeneralledgeraccountinggeneralledgerriskmanagementservicedeliveryclientsolutionsproblemresolutionfamilypartnershipsclienttingregulatyfilingsfinancialreptingRAMOJI FILM CITY, HYDERABAD 8 YEARS - 12 YEARS Read Regional Sales Lead Solid grasp of digital media, including various pricing models, targeting technologies and ad serving. Knowledge of programmatic...
salesmarketingbusinessdevelopmentaccountstargetadoperationsdigitalmediaregionalsalesclientsolutionsequipmentsupplypresentationskillsfilmvideograspidealretailbusinesscampaignsoperationsonsultMin 7-10 years work experience in building client solutions with VR/ AR and image processing architecture principles. Working knowledge on: Pre-created images and 3D models to create photorealisti...
javanetdeliverysqlserverimageprocessingclientsolutionsmobiledevelopmentinteractiondesignobjectrecognitioncomputationalphotographyhtchtml5webgldesignmobiletestingramewClient & User Support is an industry-leading and award-winning client service team starting in Hyderabad, focusing on people with a specialized knowledge of a select group of sophisticated software a...
reviewstrainingsalesexcelsoftwaresetperformancelaptopsfactsetindependencelientserviceworkstatiocollaborativeenvironmentremotedesktopproductdevelopmentusersupportmicrosoftexcelclientsolutionsOverall revenue responsibility for the region - Develop and implement sales strategy. - Enhance revenue through direct sales w/advertising agencies and clients - Provide client solutions and integrati...
managementmarketingtroubleshootingagencyprintingalespromotionprojectsalesclientsolutionsmarkettrendsOverall revenue responsibility for the region - Develop and implement sales strategy. - Enhance revenue through direct sales w/advertising agencies and clients - Provide client solutions and integrati...
managementmarketingtroubleshootingagencyprintingalespromotionprojectsalesclientsolutionsmarkettrendsOverall revenue responsibility for the region - Develop and implement sales strategy. - Enhance revenue through direct sales w/advertising agencies and clients - Provide client solutions and integrati...
managementmarketingtroubleshootingagencyprintingalespromotionprojectsalesclientsolutionsmarkettrendsManage relationships with client companies, making sure that requests are being met and that clients are satisfied with the level of service. Monitor day-to-day management of team members and activel...
financeriskbankingcompliancegeneralledgeraccountinggeneralledgerriskmanagementservicedeliveryclientsolutionsproblemresolutionfamilypartnershipsclienttingregulatyfilingsfinancialreptingDevelop designs for corporate interior projects, lead client presentations/pitches and collaboratively manage with the business manager. You will also have added the responsibility of supporting busi...
designarchitecturebusinessdevelopmentusinessinteripresentationsclientsolutionsclientpresentations© 2019 Hireejobs All Rights Reserved