Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Responsibilities:
Responsibilities Attending clients to discuss their needs and requirements. Must collaborate to chalk out strategies and campaigns that meet the client s policies and budget. Handling invoices and ...
salesmarketingbusiness developmenttargetcustomer relationstime managementtaxchalkcampaignsmanagementCashieringPhone EtiquetteCritical ThinkingPlanogramsAssociate DevelopmentLoss PreventionShrinkageDrivAttending clients to discuss their needs and requirements. Must collaborate to chalk out strategies and campaigns that meet the client s policies and budget. Handling invoices and tax receipts Clea...
salesmarketingbusiness developmenttargetcustomer relationstime managementtaxchalkcampaignsmanagementCashieringPhone EtiquetteCritical ThinkingPlanogramsAssociate DevelopmentLoss PreventionShrinkageDrivHTML5 / CSS3 / Bootstrap including simple HTML / XHTML CSS . Top news India | Breaking news stories | Latest Videos - WeRIndia Details: -Other modules: Fusion.WerIndia.co...
htmlcssjqueryjavascriptphotoshopsocial mediabreaking newstechnical skillsadssaleshtml5xhtmlvideobonusdesignbusinessbootstrapcompensationcss3Facebook
Job Responsibilities:
Analyst II (Test Lead)
Tetra Pak Global Information Management (Global IM) supports the Tetra Pak Group with all aspects of Information Management. We set the information managemen...
business requirementsplsqlsqlproject developmentsqlunit testingmanual testingmobile devicestest automationthinking skillsservice deliveryit infrastructuremobile developmentexploratory testinginformation managementproject administrationdriv
We are seeking exceptional senior quality assurance professional who will join the Digital engineering organization and play a key role in developing Waygates digital inspection solutions and prod...
internet of thingsnon destructive testingsystem designtest executioncomputer scienceteam developmentvirtual machinesquality assurancenetwork technologydestructive testingproject administrationnondestructive testingndtfueltestsdesigndriv
Job Responsibilities:
HTML5 / CSS3 / Bootstrap including simple HTML / XHTML CSS . Top news India | Breaking news stories | Latest Videos - WeRIndia Details: -Other modules: Fusion.WerIndia.com, HealthyLife.WerIndia.com...
htmlcssjqueryjavascriptphotoshopsocial mediabreaking newstechnical skillsadssaleshtml5xhtmlvideobonusdesignbusinessbootstrapcompensationcss3Facebook
Job Responsibilities:
HTML5 / CSS3 / Bootstrap including simple HTML / XHTML CSS . Top news India | Breaking news stories | Latest Videos - WeRIndia Details: -Other modules: Fusion.WerIndia.com, HealthyLife.WerIndia.com...
htmlcssjqueryjavascriptphotoshopsocial mediabreaking newstechnical skillsadssaleshtml5xhtmlvideobonusdesignbusinessbootstrapcompensationcss3Facebook
Job Responsibilities:
Occupational health and safety officers coordinate health and safety systems in an organisation. They identify hazards and assess risks to health and safety, put appropriate safety controls...
safetyinspectionsitefirst aidrisk assessmentworking at heighttag outpower toolsnoise controlhazard analysiswaste managementbudget proposalsindustrial safetysafety managementstress managementtraining programsexcavation safetydefensive drivAttending clients to discuss their needs and requirements. Must collaborate to chalk out strategies and campaigns that meet the client s policies and budget. Handling invoices and tax receipts Clea...
salesmarketingbusiness developmenttargetcustomer relationstime managementtaxchalkcampaignsmanagementCashieringPhone EtiquetteCritical ThinkingPlanogramsAssociate DevelopmentLoss PreventionShrinkageDrivResponsibilities Attending clients to discuss their needs and requirements. Must collaborate to chalk out strategies and campaigns that meet the client s policies and budget. Handling invoices and ...
salesmarketingbusiness developmenttargetcustomer relationstime managementtaxchalkcampaignsmanagementCashieringPhone EtiquetteCritical ThinkingPlanogramsAssociate DevelopmentLoss PreventionShrinkageDrivEdu: B.Tech/BS/BE/BS/MS/M.Tech /MS We are looking for a strong techie who can lead the Android OS Development to join our team. You can add value to the product through your technology skills. What...
mechanicalsafetymachineryhvacplumbingdevice driver developmentbug trackingmobile phonesversion controlmobile platformsproject managementsystem programmingcontinuous integrationoptimization strategiesdriv
Experience Required:
Minimum 3+years experience required of JEE NEET.
Key Skills:
Candidate should have min Bachelors Degree in the related subject. interpersonal skillspharmabotanyphysicszoologyteachingchemistrymathematicscommunicationIntrapersonal SkillsInterpersonal LeadershipInterpersonal RelationshipsReading PeopleVerbal BehaviorExceptional organizationEasily AdaptableSuccess Driv
Experience Required:
Minimum 3+years experience required of JEE NEET.
Key Skills:
Candidate should have min Bachelors Degree in the related subject. interpersonal skillspharmabotanyphysicszoologyteachingchemistrymathematicscommunicationIntrapersonal SkillsInterpersonal LeadershipInterpersonal RelationshipsReading PeopleVerbal BehaviorExceptional organizationEasily AdaptableSuccess Driv
About Accenture: Accenture is a leading global professional services company, providing a broad range of services and solutions in strategy, consulting, digital, technology and operations. Com...
sql serverjavascript jqueryhtml sqlsoftware engineering professional servicesvisit drivAbout Accenture: Accenture is a leading global professional services company, providing a broad range of services and solutions in strategy, consulting, digital, technology and operations. Com...
sql serverjavascript jqueryhtml sqlsoftware engineering professional servicesvisit drivWe need candidates with fluency to talk on our product variable frequency drive suitable for different industrial segment and application. Understand the application and do demo of the VFD to custome...
special purpose machinesindustrial applications business developmentsiemens tia portal excel sheetcontrol panel design servo drivHTML5 / CSS3 / Bootstrap including simple HTML / XHTML CSS . Top news India | Breaking news stories | Latest Videos - WeRIndia Details: -Other modules: Fusion.WerIndia.com, HealthyLife.WerIndia.com...
htmlcss jqueryjavascript photoshopsocial media breaking newstechnical skills adssalesPost SI Performance and HW Validation Lead for Automotive Systems Job Overview You will be part of Automotive System Performance team that is responsible for validatin...
ms officetest cases operating systemssystem integrators computer architectureapplication development optimization strategiesdrivJob Description
POSITION TITLE: FUNCTIONAL ANALYST
REPORTING TO: MADHUSUDHAN MG, ITPM e - LIMS NG - CLAP Project
REPORTING LOCATION: Bangalore
WORKING LOCATION: Bangalore ...
test casesbusiness process customer relationsdelivery erplaboratory information management system user interface designtest drivDear Candidate, Greetings from VGS Services! Urgent opening for Back office Executive --Male/Female Location : Ahmedabad(Prahladnagar,driv in,law Garden) Salary : 12-20k Exp : 1 - Any Qualificat...
database managementback office operationspetty cash calculationsoffice management mispowerpointIntroduction As an Application Developer, you will lead IBM into the future by translating system requirements into the design and development of customized systems in an agile environment. The succes...
javajavascript sqlcustomer relations htmlms sql server mean stacklead change event drivYour Role and Responsibilities Who you are: As MS Cloud Developer, you will be responsible to work with client and project managers to interpret business requirements with experience in building / ...
javajavascript sqlcustomer relations htmlms sql server mean stacklead change event drivSOFTWARE ENGINEER / SR. SOFTWARE ENGINEER AUTOSAR - COMMUNICATION DRIVER Wafer Space is looking for engineers with expertise in AUTOSAR software development to work on the product areas of ADAS, Bod...
javasql javascriptsql server jqueryembedded software design developmentsoftware developmentHTML5 / CSS3 / Bootstrap including simple HTML / XHTML CSS . Top news India | Breaking news stories | Latest Videos - WeRIndia Details: -Other modules: Fusion.WerIndia.com, HealthyLife.WerIndia.com...
htmlcss jqueryjavascript photoshopsocial media breaking newstechnical skills adssales1. Experience in Delivering Independent Mod ules & Projects in QlikView. 2. Clear understanding of (respective)T o ol Architecture which would aid in right design & development of proposed s olution. ...
ata modeling visual effects data analysis issue resolution self service work effectively commercial models agile development technical supportShould have experience in assembly, C, C++, VC++, RT Linux, Vxworks, QNX etc., Exposure to Linux driver development Application development. Electronics Design and Manufacturing jobs@datapatterns.co.i...
continuous improvement facilitationcurrent linux driveros internals system softwareembedded software application developmentdrivSOFTWARE ENGINEER / SR. SOFTWARE ENGINEER AUTOSAR - COMMUNICATION DRIVER Wafer Space is looking for engineers with expertise in AUTOSAR software development to work on the product areas of ADAS, Bod...
javasql javascriptsql server jqueryembedded software design developmentsoftware developmentGreetings from QUASTECH ( QUORATE SOFTWARE SOLUTIONS & TECHNOLOGIES ) Position Vacant for : JAVA Developer Requirement : 15 Candidates - (Fresher/ Experienced 2-3 years) Should possess knowledge o...
communicationjqueryajaxspringsqlhibernateservletsjavaswingsmysqljspracleadvancedjavaspringdicommunicationskillsperformancecorejavajavadatabaseconnectivity10ksqlserverViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:DRIVRole : Business Development Associate - Supply Location : Hinjewadi, Pune Salary : 24,000 to 26,000 per month Experience : 1 to 4 years Age : 23 to 32 years Experience
Leading MNC Hiring BE/BTech Graduates for the ServiceNow Domain Micro Academy is pleased to announce the Placement Walk in Drive for Hexaware in the domain of ServiceNow Domain Client Online Aptitud...
electronics engineering computer science ece electricals instrumentation engineering communication engineering information technology Fresher trainee walk - inTo provide financial costing and pricing deal shaping support on our largest and most complex pan European opportunities.Prepare costing analysis to ensure consistency with deal shape. Research and an...
coachingapplication evaoperations primary researchoutsourcing financedue diligence driv© 2019 Hireejobs All Rights Reserved