Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Experience. 0 to 1 Year | Openings : 1 JOB PROFILE: Candidates MUST HAVE basic skill of OOPS Fundamental Core PHP and SQL Server. Basic of MVC Architecture Basic Knowledge of PHP Framework Like Cod...
mysql css javascript oops laravel html architecture jquery basic openings sql php training yii codeigniter endframework mvcarchitecture corephp1.Candidate must have experience in core PHP and MySQL. 2.Candidate should have good experience in webservices, HTML5, CSS3 and JQuery. 3.Experience in CMS like Joomla, Wordpress. 4.Strong logical ...
css3 communication solver php cms analytical cakephp laravel html5 symfony codeigniter joomla sales endframework communicationskills corephp webservices mvcframeworkJob Description
PHP & Wordpress Developer An Wordpress Developer with PHP experience is the right candidate for the position Minimum 2 years expereince Must know Javascript Experience in API Intgration A good kn...
php html laravel codeigniter wordpress phpunit css yii mysql endframeworkResponsibilities Conducting class room training in Web Development.Taking practical training in HTML, CSS, SQL, Jquery, PHP.Assisting students one to one in learning.Assisting in admission procedure...
php communication mcs yii html css laravel jquery plsql cakephp sql endframeworkPhp Developer 1 year We need a full time php wordpress developer for our office in Mohali. Candidate should have knowledge of creating custom themes and good knowledge of wordpress and Corephp. Job ...
jquery javascript laravel html php wordpress phpmyadmin cakephp phpunit symfony mysql endframeworkFull Time Wordpress Developer WordPress Developer WordPress Developer Qualification : B.E (CS/ IT)/ B.C.A/ M.C.A/ M.E (CS/ IT) 1 to 5 Years Wordpress, PHP Role/ Skills : Plugin Development. ...
codeigniter php chat design laravel symfony mobile backend basic customization css yii cakephp integration resume html mysql wordpress phpmyadmin endframeworkCandidate should have minumums 2 year experience in in Drupal. Megento knowledge will be added advantage. Indepth knowledge in XTML, CSS, PHP (OOP), MySQL, AJAX, JQuery, Drupal . Architecting High ...
jquery nginx it css ajax lamp oop drupal mysql php memcached scalability architecting mongodb endframework applicationdevelopment highavailability hightraffic representationalstatetransfer amazonwebservicesJob DescriptionResponsibilties: - Develop hybrid mobile apps using Ionic framework. Unit test the app you develop. Deliver high quality code. Work in agile methodology. Partner closely with our ...
cakephp mobile yii angular phpmyadmin agile php phpunit oops codeigniter rest api tema laravel design symfony endframework api510 api570 symfonyframeworkPHP Programmer We are looking for experienced and responsible candidate for PHP has to be dynamic, flexible, dedicated and responsible with good communication skill, may have to deal with internationa...
salary jquery javascript phpmyadmin communication phpunit ajax mysql symfony cakephp laravel php codeigniter endframework symfonyframeworkSkill : PHP, MYSQL, JAVASCRIPT, jQuery Description : Must have thorough knowledge in PHP, MYSQL, JAVASCRIPT, jQuery. Should have knowledge of OOPS. Worked with with Core PHP, Cake PHP, Laravel, or Wor...
cloud codeigniter laravel azure php jquery integration symfony linux mysql cakephp wordpress javascript ajax gateway facebook endframework webservices corephpPHP & Wordpress Developer An Wordpress Developer with PHP experience is the right candidate for the position Minimum 2 years expereince Must know Javascript Experience in API Intgration A good kn...
php html laravel codeigniter wordpress phpunit css yii mysql endframeworkJob Description
PROFILE: PHP DEVELOPER (WORDPRESS/ CORE PHP/ MAGENTO) LOCATION: ADAJAN, SURAT, GUJARAT JOB TIME: 9.30 a.m. TO 7 p.m. SALARY: Rs. 15,000 per month to Rs. 30,000 per month CANDIDATES DUTIES AND TASK...
php mysql javascript html jquery endframework spokenenglish handlemultipleprojects crossbrowsercompatibility managementsystems developmenttools digitalmedia versioncontrolWe are looking for a Magento developer who will focus on new development of a Magento Enterprise/ Magento Community site as well as enhancing and supporting an existing Magento solution. The successfu...
jquery javascript php magento mysql sql endframework moduledevelopment sqlserver softwaredevelopment1.Candidate must have experience in core PHP and MySQL. 2.Candidate should have good experience in webservices, HTML5, CSS3 and JQuery. 3.Experience in CMS like Joomla, Wordpress. 4.Strong logical ...
css3 communication solver php cms analytical cakephp laravel html5 symfony codeigniter joomla sales endframework communicationskills corephp webservices mvcframeworkwe are looking for a web developer. Skills: PHP, MySQL, CMS like joomla/ wordpress HTML, CSS, Ajax, Java Script, jquery...
php phpunit phpmyadmin symfony mysql codeigniter cakephp css ajax html sales javascript java laravel cms jquery yii wordpress endframework symfonyframeworkCandidate should have minumums 2 year experience in in Drupal. Megento knowledge will be added advantage. Indepth knowledge in XTML, CSS, PHP (OOP), MySQL, AJAX, JQuery, Drupal . Architecting High ...
jquery nginx it css ajax lamp oop drupal mysql php memcached scalability architecting mongodb endframework applicationdevelopment highavailability hightraffic representationalstatetransfer amazonwebservices
Job Information We are looking for Full time trainers in the following domain: Soft Skills Trainers PHP , Zend Framework Trainers Android Trainers MySQL Administration Trainers MSSQL 2008 Ad...
wcf mysql html android zend net ites wpf php bpo endframework softskills hardwarenetworking msoffice customerservice dailyoperations makethingshappen html5 presentationskillsJob DescriptionResponsibilties: - Develop hybrid mobile apps using Ionic framework. Unit test the app you develop. Deliver high quality code. Work in agile methodology. Partner closely with our ...
cakephp mobile yii angular phpmyadmin agile php phpunit oops codeigniter rest api tema laravel design symfony endframework api510 api570 symfonyframeworkPhp Developer 1 year We need a full time php wordpress developer for our office in Mohali. Candidate should have knowledge of creating custom themes and good knowledge of wordpress and Corephp. Job ...
jquery javascript laravel html php wordpress phpmyadmin cakephp phpunit symfony mysql endframeworkCandidate should have minumums 2 year experience in in Drupal. Megento knowledge will be added advantage. Indepth knowledge in XTML, CSS, PHP (OOP), MySQL, AJAX, JQuery, Drupal . Architecting High ...
jquery nginx it css ajax lamp oop drupal mysql php memcached scalability architecting mongodb endframework applicationdevelopment highavailability hightraffic representationalstatetransfer amazonwebservicesWe are looking for a Magento developer who will focus on new development of a Magento Enterprise/ Magento Community site as well as enhancing and supporting an existing Magento solution. The successfu...
jquery javascript php magento mysql sql endframework moduledevelopment sqlserver softwaredevelopmentPHP Developer - 1 Year Experience Eligibility : - MCA / BE PHP , HTML 5 , CSS 3 , Ajax , Java script , Jquery , Knowledge of other framework (wordpress , joomla , Zend , magento) will be plus,...
codeigniter phpmyadmin javascript symfony laravel jquery html java ajax yii mysql cakephp joomla css php zend endframework symfonyframework html5Experience in developing the website using vue.js Must have knowledge of JavaScript, CSS and JQuery. Good knowledge of HTML 5 Knowledge of CMS (like WordPress, Joomla etc.) will be an added advantage....
php cakephp codeigniter css laravel symfony wordpress yii phpmyadmin phpunit javascript html html5 sass joomla xhtml cms endframework html5 symfonyframeworkResponsibilities Conducting class room training in Web Development.Taking practical training in HTML, CSS, SQL, Jquery, PHP.Assisting students one to one in learning.Assisting in admission procedure...
php communication mcs yii html css laravel jquery plsql cakephp sql endframeworkPHP Instructor Experience: 1 -3 years Key skills: PHP certification, deep development knowledge, good communication skills, self motivated, goal driven We have an urgent opening for PHP instructor f...
laravel cakephp php yii codeigniter endframework symfonyframework communicationskills cognitiveCandidate should have minumums 2 year experience in in Drupal. Megento knowledge will be added advantage. Indepth knowledge in XTML, CSS, PHP (OOP), MySQL, AJAX, JQuery, Drupal . Architecting High ...
jquery nginx it css ajax lamp oop drupal mysql php memcached scalability architecting mongodb endframework applicationdevelopment highavailability hightraffic representationalstatetransfer amazonwebservicesRequirements for eligibility: Must be exceptionally good in developing web based applications using PHP & MySQL plus expertise in AJAX, HTML5, CSS3 & Javascript. B.E/B.Tech/M.Sc in the field of Comput...
ajax sql symfony laravel cakephp mysql javascript visit html html5 electronics php codeigniter css3 yii jquery phpmyadmin backend endframework sqlserver1.Candidate must have experience in core PHP and MySQL. 2.Candidate should have good experience in webservices, HTML5, CSS3 and JQuery. 3.Experience in CMS like Joomla, Wordpress. 4.Strong logical ...
css3 communication solver php cms analytical cakephp laravel html5 symfony codeigniter joomla sales endframework communicationskills corephp webservices mvcframeworkwe are looking for a web developer. Skills: PHP, MySQL, CMS like joomla/ wordpress HTML, CSS, Ajax, Java Script, jquery...
php phpunit phpmyadmin symfony mysql codeigniter cakephp css ajax html sales javascript java laravel cms jquery yii wordpress endframework symfonyframeworkSoftware Engineer (PHP) Position: PHP Developer Description: Good Organisational and problem solving skills. Exceptional analytical aptitude and attention to detail. Good Team player who is self...
mysql php javascript soap ajax xml html word jquery endframework problemsolving optimizationstrategiesIngram Micro Careers - Sr Software Engineer- IND Sr Software Engineer- IND India | Mumbai, India Job ID: 29144 Job Description Position at Ingram Micro Commerce & Lifecycle Services Position title...
php cakephp jquery symfony engineering yii java software codeigniter laravel mysql oops html zend javascript sql endframework html5 sqlserver
We are looking for a Magento developer who will focus on new development of a Magento Enterprise/ Magento Community site as well as enhancing and supporting an existing Magento solution. The successfu...
jquery javascript php magento mysql sql endframework moduledevelopment sqlserver softwaredevelopmentPHP Instructor Experience: 1 -3 years Key skills: PHP certification, deep development knowledge, good communication skills, self motivated, goal driven We have an urgent opening for PHP instructor f...
laravel cakephp php yii codeigniter endframework symfonyframework communicationskills cognitivePHP Developer+ We have a job opportunity for PHP developer at Swan Solution. Experience Range: 2 - 4 years Job Location: Mumbai Joining time: Immediate to 30 days max Criteria: Education: BE /...
laravel javascript html php cakephp jquery codeigniter wordpress mysql endframework magento2Dear Candidate, Greetings from Acta Scientific Publications Private Limited! We have short listed your profile for the role of PHP Developer. Responsibilities: - Participating in a team-oriented en...
publications communication troubleshooting tests integration laravel agile database symfony codeigniter commercial road html endframework- 2+ yrs in PHP Development - Srong in PHP 2+ yrs in PHP Development - Srong in PHP 2+ yrs in PHP Development - Srong in PHP...
mysql jquery codeigniter javascript phpmyadmin symfony yii laravel cakephp html php phpunit endframework symfonyframeworkPHP Programmer We are looking for experienced and responsible candidate for PHP has to be dynamic, flexible, dedicated and responsible with good communication skill, may have to deal with internationa...
salary jquery javascript phpmyadmin communication phpunit ajax mysql symfony cakephp laravel php codeigniter endframework symfonyframeworkPhp Developer 1 year We need a full time php wordpress developer for our office in Mohali. Candidate should have knowledge of creating custom themes and good knowledge of wordpress and Corephp. Job ...
jquery javascript laravel html php wordpress phpmyadmin cakephp phpunit symfony mysql endframework
Experience. 0 to 1 Year | Openings : 1 JOB PROFILE: Candidates MUST HAVE basic skill of OOPS Fundamental Core PHP and SQL Server. Basic of MVC Architecture Basic Knowledge of PHP Framework Like Cod...
mysql css javascript oops laravel html architecture jquery basic openings sql php training yii codeigniter endframework mvcarchitecture corephpLooking For Male PHP Developer having 2 Years Of Experience
Candidate should have minumums 2 year experience in in Drupal. Megento knowledge will be added advantage. Indepth knowledge in XTML, CSS, PHP (OOP), MySQL, AJAX, JQuery, Drupal . Architecting High ...
jquerynginxcssajaxlampoopdrupalmysqlphpmemcachedscalabilityarchitectingmongodbendframeworkapplicationdevelopmenthighavailabilityhightrafficrepresentationalstatetransferamazonwebservicesDear Candidate, Greetings from Acta Scientific Publications Private Limited! We have walk in interview for the role of PHP Developer. Responsibilities: - Participating in a team-oriented environmen...
troubleshootingcodeigniterpublicationsjavascriptintegrationlaravelhtmltestsdatabasejquerysymfonycommunicationcommercialendframeworkRequired skills are :- java, spring, hibernate, html, css, jquery, javascript, php, js, framwork, etc....
htmljavaspringcsslaravelyiixhtmlhibernatephpunitjavascriptjqueryphpmyadmincodeignitercakephpsymfonyphpendframeworkhtml5symfonyframeworkangularjsMinimum 2 Years experience in PHP Developer. Exeperince In PHP Developer Must Required. Skills Required: codelgnator laravel HTML css MYSQL...
javascripthtml5jquerysasslessphpmyadminlaravelsymfonycssendframeworksymfonyframeworkResponsibilities
© 2019 Hireejobs All Rights Reserved