Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Role: Sr. Cloud Support Engineer Senior SQL DBA (L2) Relevant Work Experience: 3 to 8 Years TA Team - Please note that we will absorb 03 SQL DBAs from HAA Lite upcoming Batches and 04 from Lateral Hir...
troubleshootingcloud computingawscoresystem center configuration managernetworkinghigh sense of urgencystatements of work sowIn today s highly competitive private equity market, firms must not only deliver superior returns, but also respond to more stringent reporting requirements and increasing demands for informa...
private equityonline privacyjenkinsautomationsvndevelopment toolsfinancial servicescapital marketsfortune 500shell scriptingweb serversjavaequity marketHi Candidates Greetings of the day We are hiring for, .Net, MVC & SQL Developer The candidate should have hands on development experience in .NET, MVC, SQL. He/She should have mo...
agile methodology.netpsqlsql servermainframeasp.netmsqlmvcagilejiraHi Candidates Greetings of the day We are hiring for, PLSQL Developer Expertise in SQL and PL/SQL programming, developing complex code units. Solid Experience of creating PL/SQL ...
unixsqlmsqldata migrationplsql developerDesignation : Senior Executive -IT : Application Developer ( .Net and SharePoint related Technologies ) Roles and Responsibilities
Position Type : Full time Type Of Hire : Experienced (relevant combo of work and education) Education Desired : Bachelor of Computer Science Travel Percentage : advertisingonline privacycapital marketsdevelopment toolsfinancial servicescareer developmentcontinuous deliveryspectrum managementsoftware developmentfinancial technologypersonal development
Lead Data Engineer (ETL SSIS Azure) Location: Bangalore, Karnataka, IN Job Category: Technology Add the Middle East to your global profes...
sqljavadata warehousinginformaticapythonms crmit servicesfinancial servicesdigital transformationetlidcwinssisplsqlagiledrivesbankinganalysisenterpriseDesired Profile: Job Description Candidate should have experience developing web applications using Core PHP, MYSQL and JavaScript. Having knowledge of Drupal will be an added advantage. We expect qu...
web applicationsagile environmentcontent managementangular jsphpxmlcadleanoopsxsltmsqlmysqlagilerobotdrupalmanagementjavascriptanalyticalangulare phpWe have Urgent Requirement for Dot Net Developers. (ROHINI - NEW DELHI) Technical Qualification:- Microsoft .NET, Language - Asp.Net (C#), MVC, .net Core Backend - MS SQL Ser...
msqlasp.net mvcc shop.netasp.netasp netBusiness Intelligence Lead 1. Banking domain 2. Migration experience with PL/SQL and MSQL. 3. SSIS Or any ETL tools Added Advantage. 1. MSCRM or any CRM Knowledge....
ms crmit servicesfinancial servicesdigital transformationetlidcwinssisagileplsqldrivesbankinganalysisenterpriseJob Description 1. Extensive Java and J2EE development experience, preferably gained on complex multi-tier web-based business applications 2. Solid experience J2EE architecture, Eclipse, Tomcat, HTML...
javasqljavascriptsql serverjqueryms sql serveruser interface designms sqlspring mvctag librariesproblem solvingdesign patternsj2ee architecturebusiness requirements.NET Software Engineer .NET Software Engineer .Net Developer (1- 3 yrs) We are looking for a 1- 3 years of experienced self- motivated .NET developer to join our core dynamic team. The key skills and ...
javascriptjavacsssqljqueryprimary skillsnet frameworkpresentation skillssql serveraspnet web apiweb servicesobject oriented designrole modelobject oriented programmingclient sideunit testing Job Description and Skill set 1) Minimum 2 Years of experience required. 2) Good PHP and Msql skills. 3) Can work with minimum any one of the framewo...
Senior Data Scientist The Senior Data Scientist role will lead participation in requirement gathering including Data Discovery, system design, model implementation, code reviews, testing and maintena...
requirements gatheringdatastatisticsmodel makingpredictive modelingsystem designimage processingmodelingphdscientistPython Developer Role Description The role will participate in requirement gathering, writing clean Python code, code reviews, testing, and maintenance of the platform. You will be part of a highly ...
developmentbasicbuildpythonbusinessmysqlstatisticsbasic knowledgeplayerapplicationsDesired Profile: Job Description Candidate should have experience developing web applications using Core PHP, MYSQL and JavaScript. Having knowledge of Drupal will be an added advantage. We expect qu...
web applicationsagile environmentcontent managementangular jsphpxmlcadleanoopsxsltmsqlmysqlagilerobotdrupalmanagementjavascriptanalyticalangulare phpRoles and Responsibilities Responsibilities -
Roles and Responsibilities Responsibilities -
Job Description and Skill set 1) Minimum 2 Years of experience required. 2) Good PHP and Msql skills. 3) Can work with minimum any one of the framewo...
Job Details Job Name : Python_Pandas_Application Programming_Rajah_Raghuraman Required skills : Automation Testing,MY SQL/mSql,PL/SQL,Python,QA_Python,QTP Experience : 5 - 8 Ye...
data analysisdata analyticsweb applicationsautomation testingcompatibility testingsqlqtpbasicnumpytestspythonplsqltestingwritingseleniumanalysisanalyticsautomationStatistical ModelingStatisticsSOFTWARE DEVELOPER skills - PHP, MSQL, AJAX JOB EXP - 0 to 1 years salary - 9k to 16k number of the candidate - 02,...
sql serverjavascriptjqueryhtmlsqlphpxmlajaxmsqlmysqlsalaryandroidsoftwaregraphicsphotoshopillustratorCodeIgniterZend FrameworkLaravelSymfonyHi, Greetings from BDS Services Pvt Ltd.! Excellent career opportunity for PHP Developer for Kanjurmarg, Mumbai location. (5 minutes walk-able distance from kanjurmarg west stati...
javascriptjqueryphpcore phpcss3laravelmsqlcodeigniterhtml5php programmingphp modulesphp developer Job Description and Skill set 1) Minimum 2 Years of experience required. 2) Good PHP and Msql skills. 3) Can work with minimum any one of the framewo...
SOFTWARE DEVELOPER skills - PHP, MSQL, AJAX JOB EXP - 0 to 1 years salary - 9k to 16k number of the candidate - 02,...
sql serverjavascriptjqueryhtmlsqlphpxmlajaxmsqlmysqlsalaryandroidsoftwaregraphicsphotoshopillustratorCodeIgniterZend FrameworkLaravelSymfonySenior Data Scientist The Senior Data Scientist role will lead participation in requirement gathering including Data Discovery, system design, model implementation, code reviews, testing and maintena...
requirements gatheringdatastatisticsmodel makingpredictive modelingsystem designimage processingmodelingphdscientistPython Developer Role Description The role will participate in requirement gathering, writing clean Python code, code reviews, testing, and maintenance of the platform. You will be part of a highly ...
developmentbasicbuildpythonbusinessmysqlstatisticsbasic knowledgeplayerapplications.NET Software Engineer .NET Software Engineer .Net Developer (1- 3 yrs) We are looking for a 1- 3 years of experienced self- motivated .NET developer to join our core dynamic team. The key skills and ...
javascriptjavacsssqljqueryprimary skillsnet frameworkpresentation skillssql serveraspnet web apiweb servicesobject oriented designrole modelobject oriented programmingclient sideunit testingJob Details Job Name: Java Developer (Ind Contributor) Required skills: CSS,HTML,Java,Java Script,MY SQL/mSql,Oracle,XML Experience: 4 - 6 Years Location: Chennai Experienc...
javamysqljsphibernatespringweb servicesspring frameworkapplication frameworkssqlxmlcsshtmloracledesignmobiletomcattestingwritingsoftwareJob Title: Application Support Analyst Location: Pune Application Support of services used by Barclays Corporate & international (BCI) owned services Investigation into complex application and/or inte...
sqlunixapplication supportslatroubleshootingBatch scriptingPowerShellKornBashJenkinsWebsphereJBOSSApplication Support AnalystBladelogic
Job Details Job Name: Java Developer (Ind Contributor) Required skills: CSS,HTML,Java,Java Script,MY SQL/mSql,Oracle,XML Experience: 4 - 6 Years Location: Chennai Experienc...
javamysqljsphibernatespringweb servicesspring frameworkapplication frameworkssqlxmlcsshtmloracledesignmobiletomcattestingwritingsoftware Responsibilities
Development of responsive, scalable web applications for B-B software products
Develop frontend and backend webapp architecture
Coordinate with Produc...
Job Details Job Name: Sr .NET Developer Required skills: .NET,ASP.NET,MS SQL Server,MY SQL/mSql Experience: 2 - 5 Years Location: Chennai 1. Analyze requirements and formulate...
software development life cyclems sql serverms sqlsql serverweb servicesrisk managementdesign patternsagile methodologiessoftware developmentJob Name: Engineering Data Analyst Required skills: MY SQL/mSql Experience: 1 - 4 Years Location: Chennai Required Skills : Python, Tableau Desired Skills: SQL Job Description T...
sqldata analysismicrosoft excelcustomer relationspythontableau
Position Overview:
The Operational Reporting Analyst develops, delivers, and maintains standardized reporting by way of dashboards and automated reports across a variety of platforms and d...
reportingsql vbaautomation customer relationstechnical writing working experiencereport developmentJob Summary Information Function: Principal engineer in the development of java applications Sub-Function: Owner for the architecture, design and implementation of software applications. Job Purpose: ...
java customer relationslinux automationteam management skills strong analytical skillsstrong interpersonal skills.NET Software Engineer .NET Software Engineer .Net Developer (1- 3 yrs) We are looking for a 1- 3 years of experienced self- motivated .NET developer to join our core dynamic team. The key skills and ...
javascript java css sql jquery rimaryskills netframework presentationskills sqlserver aspnetwebapi webservices objectorienteddesign rolemodel objectorientedprogramming clientside unittesting.NET Software Engineer .NET Software Engineer .Net Developer (1- 3 yrs) We are looking for a 1- 3 years of experienced self- motivated .NET developer to join our core dynamic team. The key skills and ...
javascript java css sql jquery rimaryskills netframework presentationskills sqlserver aspnetwebapi webservices objectorienteddesign rolemodel objectorientedprogramming clientside unittesting
Position Overview:
The Operational Reporting Analyst develops, delivers, and maintains standardized reporting by way of dashboards and automated reports across a variety of platforms and d...
reportingsql vbaautomation customer relationstechnical writing working experiencereport developmentSenior Data Scientist The Senior Data Scientist role will lead participation in requirement gathering including Data Discovery, system design, model implementation, code reviews, testing and maintena...
requirementsgathering data statistics modelmaking predictivemodeling systemdesign imageprocessing modeling hd scientist© 2019 Hireejobs All Rights Reserved