Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
HR Services is critical to the overall effectiveness of theemployee experience at Microsoft. We provide the platform for end-to-end operational services and employee experiences across employee self-s...
project plansannual planninghuman resourcesbusiness planninganalyze informationhr servicesdrawlistenrhythmfinancebalancemetricsoptionsbusinessplanninganalysisAbout Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, w...
vb scriptapplication supportmusic makingprofessional servicescommunication skillstechnology operationswindows 7windows 10quality analysisinstallation testingapplication packagingOwnership of 10 to 12 client relationships at any given point in time, with ultimate responsibility for successful, on time and quality delivery of all services and Products to that client. Responsi...
sales marketing businessdevelopment target servicedelivery relationshipmanagement staffing budgeting ustomerrelations projectstaffing deliveryoperations clientsatisfaction clientrequirements dash ultimate tfThe Corporate Sales Manager (CSM) would be the key officer of the company in the region. He would be responsible to establish the sales & service operations in the territory to target and serve the co...
customerservice servicedelivery serviceoperations businessdevelopment customeracquisition relationshipmanagement csm sales logistics management opera ustomerservicedelivery atesales it business territHR Business Partner Solutions Job- Bangalore- Investment Bank (1- 8 yrs) for MNC Investment Bank Job Location : Bangalore Salary : 6 - 18 Lakhs Per Annum Financial Services Job Type : Posted on: ...
recruitment induction dvanceplanning employeeengagement projectmanagement humanresources financialservices servicedelivery employeerelations problemresolution investmentbanking processimp systemmaintenanceJob|| Manager/ AM - External Audit for MNC Consulting, Bangalore/ Kochi( CA/ CPA: 4yrs+) To Apply This Job AddThis Sharing Buttons Job Description - MNC Consulting Firm ( Shared Service ) Profile - Ex...
reviews cv risk gdc cima embedded gps business metrics clarity training steps cfa rainingmanagement musicmaking externalaudit softskillstraining softskills servicedelivery riskmanagementAbout the position The Associate - 1 Broadly, the key responsibilities [KI1] are:
About the position The Associate - 2 should have prior experience either during CA Articleship or other relevant experience in audit attestation domain and should have proven experience in ...
sharedservicecenter teammanagementskills corporatesocialresponsibility msoffice lifesciences qualityaudit riskmanagement teammanagement servicedelivery technicalskills managementskills communicationskills managementaccounting investmentmanageSr. Developer / Lead Oracle Commerce Cloud Major Responsibilities include but are not limited to: Consult directly with customers at various levels functional and technical. Collect and analyze cust...
technicalrequirementsgathering webservices musicmaking uidevelopment changecontrol problemsolving changerequests servicedelivery codingpractices externalclients projectexecution tatementsofw ksowRole & Responsibilities are mentioned below:- Visionary / Information Bearer Decision Maker Administration and Support Program, Product and Service Delivery Financial, Tax, Risk and Facilities Ma...
tax risk management facilities fundraising dataanalysis administration riskmanagement customerservice publicrelations servicedelivery ccess business planning analysisINCIDENT/ PROBLEM Management Analyst Objective of job:Monitor IT Infrastructure hardware, Operating system and application alerts generated by the tools and investigate the fault based on the Knowled...
iso it itil kpi atr sla slas itsm rca tilv3 servicemanagement rootcause rootcauseanalysis itinfrastructure problemmanagement servicedelivery knowledgebase communicationskills writtencommunicationYour key responsibilities Responsible for effectively engaging with clients and executing engagements (as detailed out below) under the supervision of Seniors and Managers Client Engagements primar...
enterpriserisk riskmanagement businessprocessmanagement problemsolving codeofconduct enterpriseriskmanagement riskassurance internalaudit riskadvisory servicedelivery tatementsofworksowScogo Networks Pvt. Ltd. is a search for a React Native Developer in Pune location (Relocation support will be provided) having expertise in React.JS and interested to work in a fast - moving startup ...
itservicedelivery softskillstraining usecases softskills servicedelivery serviceindustry serviceproviders mobiledevelopment financialinclusion businessrequirements applicationdevelopment bugfixingMinimum 5 years experience as Head - Operations in Service industry. Should be well versed with functioning of a Service Industry. Should be efficient in managing the Operations of the entire Compan...
servicedelivery hr sales finance marketing logistics operations ServiceImprovement TransitionManagement ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement erviceLevelAgreements Offsh ingIT Sales, Corporate Sales,Digital marketing. Business Development Manager job in kolkata | Skyram Technologies Career Interested to be a part of our team, but not sure where to start At Skyram, w...
sales marketing businessdevelopment customerrelations target fmcgsales newbusiness costeffective leadgeneration timemanagement targetaudience servicedelivery technicalskills atesales salesnetwTaking ownership of product support and product enhancements. Handling team members like Solution Architect / Coders / Database Admins / IT Infra / Testing / Product Service Delivery and etc. Handing ...
object codereview clientside controlsystem problemsolving versioncontrol productservice servicedelivery agiledevelopment productdevelopment entedprogramming ephp productsupp kingexperienceChip in to support aspects of planning, design, development and delivery of system solutions for a specific business or technology area, in alignment with design and architectural standards and busine...
itservices servicequality servicedelivery processanalysis qualitystandards systemarchitecture functionalspecifications it sap sox gxp risk fact design demand english business planning analysis edicalMANAGER - TECHNICAL SUPPORT Manager - Technical Support JOB ROLE: Technical Support Manager Key Deliverables A new opportunity has arisen within TelExcell for a Technical Support Manager. The po...
postsales salessupport salesprocess servicelevel customerservice servicedelivery managedservices technicalsupport corporateliaison productmanagement servicemanagement tatementsofworksow systemintJob Skill: Business Service delivery Designation: Career Level - 12-Associate Job Location: Chennai Qualifications: Any Graduation Years of Experience: 1-3 year...
servicedelivery businessoperations professionalservices performance administration ServiceImprovement TransitionManagement Offshoring erviceLevelAgreementsJob Skill: Business Service delivery Designation: Career Level - 13-Associate Job Location: Chennai Qualifications: Any Graduation Years of Experience: 0-1 year...
servicedelivery businessoperations professionalservices visit drives business strategy analytics reporting operations consulting monitoring innovation performance instructions administration erviceLevelAgreementsJob Skill: Trade Finance Designation: Career Level - 08-Consultant Job Location: Bengaluru Qualifications: Any Graduation Years of Experience: 8-9 years Abo...
lettersofcredit tradefinance servicedelivery businessprocess corporatebanking seniormanagement businesssolutions professionalservices it icc set visit credit import drives finance banking business strategy xportCollection and Documentation: Documents such as Welcome letter, Demand Letter, Allotment letter, Reminders, Cost sheet, Receipts, MOFA, Agreements Etc. Follow up for payment through Reminder letters...
sales mis accounts tat banking customerrelationshipmanagement costsheet socialmedia servicedelivery queryresolution customerexperience verbalcommunication interestcalculation customerrelationship indingoppAre you passionate about the financial markets Are you an innovator who loves to solve problems We are looking for someone to use their expertise and join UBS team in Mumbai - strong understanding ...
standardoperatingprocedures staticdata dataquality datacontrol referencedata datamanagement servicedelivery operationalrisk serviceindustry workingexperience tatementsofworksowHe/ She should be able to demonstrate a capability to be a one stop person for an update on the project, in a manner that is satisfactory to all the stakeholders, with proper analytics . An ability to...
delivery java reporting rofessionals migrationmanagement resourcemanagement projectmanagement customerrelations portfoliomanagement erppackage changemanagement servicedelivery talentmanagement servicedeskAs a Delivery Analyst ( Technical Support) , you will work closely with the Service Delivery Technical Support Managers , Leadership group , supporting customers for Level 1 cases. This is an excellen...
delivery quality documentation ustomerrelations systemsetup equipmentsupply customersupport incidentmanagement technicalsupport benefitsadministration servicedelivery managementskills servicelevelLooking to become a leader in the Human Capital Management (HCM) space. As a Customer Service Manager, you will work clo . Human Capital Management- Customer Service Manager @ EPAY Systems Human Capi...
accounts sales compliance banking ustomersupport servicedelivery servicelevel timeattendance humancapital generalledger humancapitalmanagement customerservice systemsetupUnderstanding the Business potential for the company by analyzing the existing offline information about the Customer, We have CRM implemented need to work with the CRM Package, hence CRM Process know...
servicedelivery mail sales email business handover accounts ServiceImprovement TransitionManagement Offshoring ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement ProblemManagement Parcels Scan iCal PostalRegulationsWork with Client stake-holders to provide visibility and guidance around performance, work-flows and SLA/ KPIs Minimum 1 year as a Ops Delivery Manager in the Oil and Gas Domain Might have worked for...
gas excel itil rca lean reviews b2c retail finance b2b ci usinessfinance technicalprocess equipmentsupply servicemanagement followingup bordercontrol deliveryoperations itilfoundation servicedelivery
people advisory, people and change, organisation and change, people and organisation, hr consulting, change management, organization design, Talent Strategy People Programs , People Advisory Servi...
continuousimprovementfacilitation hrconsulting riskmanagement clienthandling humanresources servicedelivery clientsolutions equipmentsupply changemanagement seniormanagement talentmanagement hrtransformation managementskills peopleleadershipPosition: Business Development Executives Preferred Candidates: Male / Female Location: New Delhi , Cochin , Mumbai , Bangalore , Chennai Department: ESMG No Of Positions: 5 each Qualification...
sales marketing customerrelations businessdevelopment coldcalling servicedelivery enterprisemarketing it business handover enterprise architects ServiceImprovement TransitionManagement erviceLevelAgreementsPosition: Business Development Manager Preferred Candidate: Male / Female Location: New Delhi , Cochin , Mumbai , Bangalore , Chennai Department: ESMG No of Positions: 1 no each Qualification:...
sales marketing businessdevelopment customerrelations target servicedelivery enterprisemarketing it finish business handover enterprise architects ServiceImprovement TransitionManagement erviceLevelAgreementsUnderstanding the Business potential for the company by analyzing the existing offline information about the Customer, We have CRM implemented need to work with the CRM Package, hence CRM Process know...
servicedelivery mail sales email business handover accounts ServiceImprovement TransitionManagement Offshoring ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement ProblemManagement Parcels Scan iCal PostalRegulationsPosition: Enterprise Market Analyzer cum Coordinator Location: New Delhi , Cochin , Mumbai , Bangalore , Chennai No of Positions: 2 each Qualification: MBA / BBA / Any Graduation with Computer Knowled...
servicedelivery mail sales business handover optimizer enterprise accounts ServiceImprovement TransitionManagement ITOutsourcing IncidentManagement ServiceDesk ServiceDelivery erviceLevelAgreements Offsh ingUnderstanding the Business potential for the company by analyzing the existing offline information about the Customer, We have CRM implemented need to work with the CRM Package, hence CRM Process know...
servicedelivery mail sales email business handover accounts ServiceImprovement TransitionManagement Offshoring ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement ProblemManagement Parcels Scan iCal PostalRegulationsBrief Job Profile: Interacting with the customers to understand the requirement Well, Designing the IT solutions with the help of internal Solution specialists & Solution architects, prepare, present,...
sales marketing businessdevelopment customerrelations target servicedelivery enterprisemarketing it finish business handover enterprise architects ServiceImprovement TransitionManagement erviceLevelAgreementsBrief Job Profile: Understanding the Business potential for the company by analyzing the existing offline information about the Customer, We have CRM implemented need to work with the CRM Package, he...
servicedelivery mail sales business handover accounts ServiceImprovement TransitionManagement ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement erviceLevelAgreements Offsh ing ProblemMInteracting with the customers to understand the requirement Well , Designing the IT solutions with the help of internal Solution specialists & Solution architects , prepare , present , conveyance the...
sales marketing businessdevelopment customerrelations target servicedelivery enterprisemarketing solutionarchitecture it finish business handover enterprise architects architecture ServiceImprovement TransitionManagement Offshoring ITOutUnderstanding the Business potential for the company by analyzing the existing offline information about the Customer, We have CRM implemented need to work with the CRM Package, hence CRM Process know...
servicedelivery mail sales email business handover accounts ServiceImprovement TransitionManagement Offshoring ITOutsourcing IncidentManagement ServiceDesk ServiceDeliveryManagement ProblemManagement Parcels Scan iCal PostalRegulationsBrief Job Profile: Interacting with the customers to understand the requirements. , Designing the IT solutions with the help of internal Solution specialists & Solution architects, prepare, present, c...
sales marketing customerrelations businessdevelopment coldcalling servicedelivery enterprisemarketing it handover enterprise architects ServiceImprovement TransitionManagement erviceLevelAgreements Offsh ingHiring: Associate Director- US Tax (Bengaluru) Associate Director- US Tax (Bengaluru) Role Description: This individual would play a senior leadership role at the Business Tax Services (BTS) practic...
finance compliance reporting advisory lientengagement taxreturns peoplemanagement ustax servicelines peoplemanagementskills servicedelivery changemanagement customerrelations© 2019 Hireejobs All Rights Reserved