Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Position Title: Team Lead – Job Analysis Evaluation & Special ProjectsFunction: Human ResourcesJob Band: 8Location: MumbaiEducation: MBA HR (Full time)Experience: 12 to 14 yearsJob Purpose:To be...
AnalysisIts fun to work at a company where people truly believe in what they are doing! Job Description Position Summary The Litigation Analyst works as a member of the Operations te...
customer relationsmusic makingslatroubleshootingproject managersclient servicesequal employment opportunitydata processingunixenvironmentcomputer scienceMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roiresearchtestssalespopemailchatgapmarketingfitwhite papersfile transfersecondary researchresearch analysismarket researchgap analysisRoles and Responsibilities 1.1. Receiving patient on first visit, taking history, & documenting details. 1.2. Educating patient about procedure and process. 1.3. Briefing patient a...
summarizing informationscanvisithistoryrecordsbriefingeducationconsultingdocumentationSummary ReportsSummariesSynthesizingSupporting OthersSummation iBlazeEstablishing PrioritiesCT SummationTrial ExhibitsInterrogatoriesLogic BISTFastscaRoles and Responsibilities 1.1. Receiving patient on first visit, taking history, & documenting details. 1.2. Educating patient about procedure and process. 1.3. Briefing patient a...
medicineopdsurgeryinsurancenursingsummarizing informationscanvisithistoryrecordsbriefingeducationconsultingdocumentationSummary ReportsSummariesSynthesizingSupporting OthersSummation iBlazeEstablishing PrioritiesRoles and Responsibilities -To prepare discharge summaries, death summaries, DAMA summaries and clinical summaries. - Report dispatching. - Facilitating in signing of the reports by the Consul...
summarizing informationdamasigningclinicaldischargefacilitationSummary ReportsSummariesSynthesizingSupporting OthersSummation iBlazeEstablishing PrioritiesCT SummationTrial ExhibitsInterrogatoriesSCPCBGANSatellite ModemsUHFThe Hosting Services Analyst works as a member of the Operations team within Epiqs Electronic Discovery division. In this role, Analyst is responsible for both overseeing Hosting Services Analy...
equal employment opportunityleadership skillscomputer sciencehosting servicesproject managersclient servicesmusic makinglitigation support
Greenfields Management And Placement Consultant Pvt. Ltd. ,Pune. Required For European Multinational Company For A Good Opportunity In And Around Pune. Job Title: Engineer-M...
preventive actionroot causecustomer servicecustomer requirementssample preparationdigital photographyservice workcontinuous improvement facilitationcorrective preventive actionMedical transcriptionists typically do the following: Listen to the recorded dictation of a doctor or other healthcare worker. Interpret and transcribe the dictation into patient history, exam notes, ...
follow directionsestablishing prioritiessummariesinterprettrial exhibitsct summationhistorycalmingsummation iblazehealthcareinterrogatoriessynthesizingsupporting othersgoal seekdischargesummarizing informationsummary reportslistenmedicalJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing PriitiesMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roiresearchtestssalespopemailchatgapmarketingfitwhite papersfile transfersecondary researchresearch analysismarket researchgap analysisRoles and Responsibilities Visits and Trainings a. Regular visits to Shanti Juniors Centres for : b. Seat Placement (dispatch of SEAT and its follow up till SEAT Placement) c. Sea...
teachingenglishseminarsdeliverysaleswinning others overquality auditwritten communicationprogramme implementationbaraptformsskypevisitvenueproofmantrafullfinal settlementhodJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing Priities
Detailed Job Description
Role
Pre Sales resources would be allocated to certain Sales Account Managers to support in responding to RFPs (Request for Proposal) from the client / prospe...
proposalsworddeliveryexcelpresalesenglish languagerfpscostingsales accountmarketingenglishbusinesswellnesssalesprogram managementbusiness developmentupsellingcommandtargetexcel powerpointJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing Priities
Detailed Job Description
Role
Pre Sales resources would be allocated to certain Sales Account Managers to support in responding to RFPs (Request for Proposal) from the client / prospe...
salesbusinesswellnessprogram managementupsellingenglish languagesales accountenglishproposalsexcel powerpointdeliveryJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing PriitiesJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing PriitiesJob involves research, extraction and analyzing industry / commercial information from Internet, prepare content / Summaries for foreign clients. Work Experience : 1 - 2 years, Fresher also welcome ...
customer relationsdatabase administrationrequirementspcrrecruitingcomresearchcommercialSummariesSynthesizingSummation iBlazesummarizing infmationSummary RepSuppting OthersEstablishing PriitiesMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roi research tests sales pop email chat gap marketing fit hitepapers filetransfer secondaryresearch researchanalysis marketresearch gapanalysis1. Visits and Trainings Regular visits to Shanti Juniors Centres for : a. Seat Placement (dispatch of SEAT and its follow up till SEAT Placement). b. Seat Training. c. Teachers sourcing and recrui...
marketing sales cluster target reviews retail inningothersover programmeimplementation qualityaudit businessdevelopmentMarket Research Analyst Experience : 1 2 Yrs Responsible for doing research on an assigned topic, and providing analysis and reporting. While the domain of knowledge will vary greatly across indus...
roi research tests sales pop email chat gap marketing fit hitepapers filetransfer secondaryresearch researchanalysis marketresearch gapanalysisTerritory Manager Academic and Audit Key Responsibility Areas 1. Visits and Trainings a. Regular visits to organisations Centres for : b. Seat Placement (dispatch of SEAT and its follow up till SE...
academicscademicresearchleadershipcommunicationskillsteamskillsTerritory Manager Academic and Audit Key Responsibility Areas 1. Visits and Trainings a. Regular visits to organisations Centres for : b. Seat Placement (dispatch of SEAT and its follow up till SE...
academicscademicresearchleadershipcommunicationskillsteamskillsGreetings from Gangar Eyenation! Company Profile- Gangar Eyenation is one of the fastest growing optical retail chain in India. In just a span of four decades, GANGAR EYE NATION has managed to bui...
cash handling cashier activities advanced excel typing speed back office english typing communication skills backend billing Computer Operator data entry© 2019 Hireejobs All Rights Reserved