Power BI Engineer

4.00 to 6.00 Years Ahmedabad 31 Jul, 2020

Job Location	Ahmedabad
Education	Not Mentioned
Salary	Not Disclosed
Industry	IT - Software
Functional Area	General / Other Software
EmploymentType	Full-time

Job Description

Experience range : at least 4+ years of relevant experience

Job specification / Description:

Must have experience on Microsoft Power BI and should have worked in Finance Domain.

Experienced in Power BI development and administration, Building Analysis Services reporting models and Developing visual reports, dashboards and KPI scorecards using Power BI desktop.

Familiar on QlikView dashboard development and Cognos analytics.

Excellent organizational and troubleshooting skills with attention to details.

QlikView certification is preferred.

Must have experience into client communication and requirement gathering. Must be comfortable working as individual contributor/team member.

Clear English verbal and written communication ability a MUST.

Keyskills :
power bianalysis servicesbuilding analysisclient communicationwritten communicationtroubleshooting skillskpicognosfinanceenglishqlikviewanalysisanalyticsreportingdashboardcommunicationadministrationtroubleshootingDAXPowerView

APPLY NOW

Power BI Engineer Related Jobs

Foreign Exchange Services (FES)

LIVE CONNECTIONS PLACEMENTS PVT LTD

2.00 to 7.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
forex cardtravel card

View & Apply
Android Developer

Miracle Consultancy

1.00 to 6.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
androidandroid framework

View & Apply
Commercial leasing Manager

ASATKALPA PRIVATE LIMITED

5.00 to 10.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
leasingcommercial leasing

View & Apply
Reliance Nippon Life Insurance- DM Channel

RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED

1.00 to 6.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
life insuranceinsurance brokinginsurance sales

View & Apply
Relationship Manager - HDFC Bank Relationship Channel

Tata AIA Life Insurance Company Limited

1.00 to 2.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
insurance salesfinancial services

View & Apply
Relationship Manager - Virtual Bancassurance HDFC

Tata AIA Life Insurance Company Limited

1.00 to 2.00 Years Ahmedabad 26 Apr, 2024

Keyskills :
bancassurance salesfinancial services

View & Apply
Key Account Manager for Leading NBFC Wealth and Broking Company

Career Shaper Hiring For Leading NBFC/Financial Services Client

1.00 to 6.00 Years Ahmedabad 24 Apr, 2024

Keyskills :
brokingstock tradingsalesdemat accountswealthinsurancemutual fundsstock brokingdemat

View & Apply
Information Technology Executive

Arohan Financial Services Limited

2.00 to 6.00 Years Ahmedabad 24 Apr, 2024

Keyskills :
TroubleshootingTechnical SupportNetwork AdministrationInformation TechnologyIT OperationsAnalytical skills

View & Apply
Telecaller Manager (Life Insurance)

PEOPLE RESOURCES Hiring For Aditiya Birla Life Insurance

1.00 to 5.00 Years Ahmedabad 24 Apr, 2024

Keyskills :
life insurancetelecallingsales executionafter sales servicetelecom salesinsurance sales

View & Apply
Junior Research Analyst

Young Turtle LLP

2.00 to 6.00 Years Ahmedabad 24 Apr, 2024

Keyskills :
data collectionstatistical analysisquantitative indicatorshigh frequency trading strategiesmathematical modellingsimulation techniquestimeseries analysis

View & Apply

Power BI Engineer

Job Description

Power BI Engineer Related Jobs

Foreign Exchange Services (FES)

Android Developer

Commercial leasing Manager

Reliance Nippon Life Insurance- DM Channel

Relationship Manager - HDFC Bank Relationship Channel

Relationship Manager - Virtual Bancassurance HDFC

Key Account Manager for Leading NBFC Wealth and Broking Company

Information Technology Executive

Telecaller Manager (Life Insurance)

Junior Research Analyst

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers