hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Enterprise Change Lead Liquidity

3.00 to 5.00 Years   Bangalore   03 Aug, 2019
Standard Chartered Bank Ltd
Job LocationBangalore
EducationNot Mentioned
SalaryNot Disclosed
IndustryEducation / Training
Functional AreaGeneral / Other Software
EmploymentTypeFull-time

Job Description

The Business Analyst will:Work collaboratively with Country Finance, Treasury, Group Liquidity Regulatory reporting and BAU teams to understand requirements and articulate them within the Business and data requirements documentActively engage with stakeholders (business, ITO, CDO partners) to deliver appropriate solutions as per planned timelinesSupport the project manager from conception through to post-implementation review, ensuring all necessary governance steps are followed correctly and completely

  • Follow the structured approach to programme delivery and provide regular risk/issue updates to the project Manager
This role requires strong business analysis skills, sound understanding of the Systems Development Life Cycle, an understanding of functional areas specifically around the Liquidity risk and reporting domain to satisfy delivery of business benefits.RESPONSIBILITIES Business Methodology To act as a business solution owner of the projects target state and support analysis included in relevant concept and methodology papers required for preparation of BRDsTo be accountable for ensuring that detailed requirements are documented in BRDs, and are duly signed off by relevant stakeholdersTo ensure that the new solutions comply with internal procedures / external regulatory guidelines and project deliverables are properly understood by business stakeholders, project team, and end-users.Solution architecture To validate that the strategic system architecture proposed by Technology is fit for its business purpose and is in line with the agreed business target stateTo drive prioritization taking into consideration business benefits, delivery timelines, system performance etc.To centrally coordinate system interfaces/dependencies/change releases for the Treasury and Liquidity Reporting work streams and ensure alignment across all centresCommunication and Change Management Communication with the policy owners and producers of regulatory and internal risk metrics to understand their processes and to push the business perspective.Communication with desks to understand user needs and resolve issuesUser Acceptance Testing To support the development of testing packs with predefined results setsTo review test cases ensuring completeness of UAT coverageTo monitor any gaps/bugs identified, and work with Technology counterparts to track progress and ensure resolution,

Keyskills :
testcaseslifecycleriskmetricsliquidityriskbusinessanalysischangemanagementbusinesssolutionacceptancetestingprogrammedeliverysystemarchitecturetatementsofwksowregulatyrepting

APPLY NOW

Enterprise Change Lead Liquidity Related Jobs

© 2019 Hireejobs All Rights Reserved