| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
| Ajax Jobs |
| Designing Jobs |
| ASP .NET Jobs |
| Java Jobs |
| MySQL Jobs |
| Sap hr Jobs |
| Software Testing Jobs |
| Html Jobs |
| Job Location | Bangalore |
| Education | Not Mentioned |
| Salary | Rs 50,000 - 3.0 Lakh/Yr |
| Industry | IT - Software |
| Functional Area | General / Other Software |
| EmploymentType | Full-time |
KIndly find the job description: Sourcing Team: (2 Positions at Bangalore) We are looking for Jr. Resources who has an expert on the below 1. Good Experience in IT and Semiconductor requirements sourcing. 2. Minimum 1 -2.5 years (recent /current ) experience handling semiconductor (VLSI) requirements. 3. Hands on experience in sourcing for Verification, Analog / Digital Layout, Physical Design , Timing Engineer, Circuit Design , Electronic Design Automation , DFT, PDK requirements. 4. Willing to work as Individual Contributor 5. Develop and implement sourcing / search strategies for highly talented and peers candidates through creative methods, utilizing Social media, professional networking sites and passive talent pools Recruiter (1 Position at Bangalore): Experience: 1. 3 to 6 yrs. of Recruiting experience in Semiconductor/VLSI Domain (Corporate recruiting experience preferred). 2. Person should worked on Design Verification (Mixed Signal, Analog, Digital) Core Embedded Software Design Silicon Validation Board Design DFT (Design for testability)/ Physical id design 3. Experience working in a fast paced environment with the ability to multi-task while handling high volume of recruiting. 4. Must be detail oriented and self-motivated with strong initiative and follow-through, excellent communication and organizational skills. ,
Keyskills :
recruitmentscreeningsourcingrecruitingsocialmediacircuitdesignphysicaldesignembeddedsoftwaresiliconvalidationdesignverificationdesignautomationdftpdkertmsdesigntimingtalsnetwkingsites