hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Princ Anlst Business Analysis

4.00 to 6.00 Years   Bangalore   08 Aug, 2019
GLOBALFOUNDRIES
Job LocationBangalore
EducationNot Mentioned
SalaryNot Disclosed
IndustryManufacturing
Functional AreaDBA / Datawarehousing
EmploymentTypeFull-time

Job Description

  • Support the implementation of custom-built applications in .NET/CLOUD used globally at all GLOBALFOUNDRIES locations
  • Work with the onsite-offshore team to provide solutions for the business based on best practices.
  • Responsible for the software development life cycle; right from translating business requirements into technical design document, development, testing and deployment in line with company s SDLC methodology
  • Provide Application support and administration for business applications. Available for mission critical applications as and when needed
  • Provide solutions of new systems implementations based on industry trends as well as support and maintenance for existing systems using technologies in .NET/CLOUD
, Essential Knowledge:
  • Fluent in frameworks - ASP. NET 2.0 and above
  • Must be hands-on person with strong experience in C#, ASP.NET, ADO.NET/EF, WCS and MS SQL.
  • Experience in .Net application deployment, monitoring & administration
  • Familiar with working on Oracle RDBMS 10G and above
  • Hands-on experience with database design, PL/SQL and optimization of SQL Stored Procedures and JavaScript coding
Desirable Skills:
  • Experience in Web Forms, Telerik Controls and Web services.
  • Team player with positive attitude
  • Strong communications skills and ability to collaborate well with members from various geographical locations.
  • Ability to work under pressure with tight deadlines
Education & Experience:
  • Degree in Computer Science or equivalent with minimum 4-6 years relevant experience
  • Experience in Semiconductor/Manufacturing domain is preferred
  • Microsoft Certified Solutions Developer (MCSD) preferred.

Keyskills :
sqlsoftwareadministrationtechnicaldesignjavascripttestingmcsdtelerikwcsdonetaclerdbmsplsql

APPLY NOW

Princ Anlst Business Analysis Related Jobs

© 2019 Hireejobs All Rights Reserved