Solution Architect

Job Description

Essential Functions of the Job:A Solution Architect provides architecture leadership & subject matter expertise to client engagements focusing on complex & innovative products and reusable assetsPrior to kicking off a project as part of a product life cycle the solution architect develops solution plans intended to support business investment decisions which means they must hold the appropriate balance between costs, risks and quality of the productThe Solution Architect defines the solution architecture for the design and integration of new and existing solutions, focusing on small components of solution configurations, applying strong technical skills and incorporating existing solutions to solve problemsFor that, he/she works closely and continuously with the business/client to focus on meeting business/client requirements and incorporating broader aspects such as overall product costs/revenue, data privacy & sovereignty, business continuity, information security, integration with other systems, etc.He/She researches IT products to use for the solution architecture, performing cost benefit analysis.He/she is key in identifying, defining and implementing reusable assets and standards. He/she is also responsible for adherence to these standards and consumption of reusable assets across products and portfoliosHe/she ensures relevant technical strategies, policies, standards and practices are applied correctly across Technology programs/projects and products.He/she also contributes to the development of architecture governance structures, methodologies and compliance activitiesHe/she works with vendors to assess vendor products, understand vendor s delivery models and assist in implementing them at EY.A solution architect can work across multiple projects with varied stakeholders. He/she sets architectural direction, builds consensus, mediates conflicts providing technical leadership and advisory services to the business. He/she anticipates needs and potential objections and helps to create an environment which solicits positive contributions from all participants: Solution and Technical Architects, engineering teams, product manager, project managers, product analysts, test and project teams, Information Security and OperationsHe/she has excellent interpersonal communication and organizational skills that are required to operate as a leading member of global, distributed teams that deliver quality services and solutions.He/she cultivates lasting relationships across business, IT and vendors / industry analysts to maintain insight into the broader enterprise as well as industry trends.He/she recognizes industry technology trends and emerging technologies, understands how they apply to EY and can drive their adoption into our organization.He/she evangelizes and encourages importance of technical quality, emerging technologies, sharing & experimentation across the org through mentoring, hackathons, communities etc.He/She drives an ongoing communication plan to educate stakeholders on the purpose and benefits of solution architectureHe/She guides others in resolving complex issues in solution architecture and solves complex, escalated aspects of a projectHe/She monitors the progress and the quality of the project and reviews and develops due diligence to confirm the developed solution complies with architectural designAnalytical and Decision-Making Responsibilities:A Solution Architect:Converts business and technical requirements into technology solutionsConsiders the art of the possible, compares various architectural options based on feasibility and impact, and proposes actionable plansAssesses and manage multiple technical challenges simultaneouslyEnsures architectural deliverables meet schedules and estimatesApplies judgment when implementing application development/engineering methodologies, processes, and practices, to meet all project requirements; including product design, information security, code maintainability and reliabilityAnticipates project issues and risks before they occur, and work with teammates to identify and implement solutions or mitigations with relevant stakeholdersShould possess good product instinct and excellent project management skills to push projects over the finish line with sound planning and persistent executionDemonstrates strong analytical and technical problem-solving skillsCan analyze and operate at various levels of abstractionCan balance what is strategically right with what is practically realistic by balancing the risk to the project, product or to the firm.Supervision Responsibilities:A Solution Architect:Collaborates with peers and lead architects which allows him/her to grow in the role of a solution architectAble to delegate when appropriate but leads by example when requiredReceives general direction from the Solution Architecture Leadership Team. Works with architecture leaders and peers, business stakeholders/clients, product owners, project managers, product managers, engineers, product analysts and business stakeholders to drive a project s progress and ensure successDue to our global organization and global operating model there may be cross border reporting lines (your manager may be based in another country).The role is primarily an individual contributor in a Solution Architecture team.Knowledge and Skills Requirements:A Solution Architect:Demonstrates good understanding of solution architecture.Can adopt and relate new technologies to the set of problems we face at EY while adhering to security and other EY standardsCan communicate solutions, ideas, suggestions to a variety of (business) stakeholders effectively and comprehensiblyPossesses strategic business acumen and understanding of organizational strategyDeep understanding of Application, Infrastructure and security architecture and non-functional aspects like Performance, Scalability, Reliability, Availability, all the so-called capabilities of a systemUnderstanding of latest cloud computing and data technologies, business drivers, emerging computing trends, and deployment options.Expert in defining, designing and developing distributed and scalable products and services, including reusable domain-specific microservices on multi-platform /hybrid clouds (such as Microsoft Azure, AWS, Google Cloud Rackspace, VMware, or OpenStack)Able to navigate the EY organization to facilitate work beyond the immediate technical teamExperience with Agile & DevSecOps methodologies;Excellent project management, collaboration, interpersonal and communication skillsBroad understanding of EY Technology, including service offerings, technical standards and policies, technical and business strategies as well as organizational structureStrong collaborator willingness to share ideas, documentation and leading practicesConceptual and analytical thinker ability to extract, analyze, and document complex business and technical requirements/strategiesJob Requirements:Education:Bachelor s Degree or equivalent in Engineering, Computer Science, IT, Mathematics, Economics.Experience:Minimum of 8 years overall IT industry experienceMinimum of 1 year in a solution or technical architect role using service and hosting solutions such as private/public cloud IaaS, PaaS and SaaS platformsExperience of optimizing systems and working with the business to solve problems using technology such as Microsoft-centric solutions based on industry standards using any Azure IaaS, PaaS and SaaS capabilities.Possesses deep knowledge on solution architecture spanning across all aspects of each systemExperience with any claims-based authentication (SAML/OAuth/OIDC), MFA, JIT, and/or RBAC / Ping etc.Knowledge of cloud security controls including tenant isolation, encryption at rest, encryption in transit, key management, vulnerability assessments, application firewalls, SIEM, etc.Experience with mission critical technology components with DR capabilitiesExperience with multi-geography, multi-tier service design and managementUnderstanding of financial management, experience in solution planning and product cost estimationExperience supporting peer teams and responsibilities; such as infrastructure, operations, engineering, info-securityOther RequirementsAs this is a role with global focus and responsibilities, you may be required to work outside of the normal working hours in your time zone to partner with other IT Services staff globally.This role may also include travel, both domestic and international.Desired QualificationsConfiguration management and automation tools such as Azure DevOps, Ansible, Puppet, Chef, Salt, etc.Software development full lifecycle methodologies, patterns, frameworks, libraries and toolsOne or more programming and scripting languages such as JavaScript, PowerShell, Bash, SQL, .NET, Java, Python, PHP, Ruby, PERL, C++, etc.Relational, graph and/or unstructured data technologies such as SQL Server, Azure SQL, Cosmos, Azure Data Lake, HD Insights, Hadoop, Neo4j etc.Data movement and transformation technologies such as Alteryx etc.,

Keyskills :
javadeliverycustomerrelationssalesenvironmentproductlifecyclesubjectmatterexpertisepowerbisqlserverlifecycleitservicesdataprivacycostbenefitmusicmakingtatementsofwksowcrossb