| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
| Ajax Jobs |
| Designing Jobs |
| ASP .NET Jobs |
| Java Jobs |
| MySQL Jobs |
| Sap hr Jobs |
| Software Testing Jobs |
| Html Jobs |
| Job Location | Hyderabad |
| Education | Not Mentioned |
| Salary | Not Disclosed |
| Industry | IT - Software |
| Functional Area | General / Other Software |
| EmploymentType | Full-time |
Mandatory skills: Java, Microservices, Kafka, Camel Experience: 5-10 years Required: Experience with full-stack Java-based enterprise technologies and tools using Java, Node.js, JavaScript, Microservices architecture, Spring, Apache Kafka, Apache Camel and REST Must be able to code in prevailing technologies including Java, Spring, SQL including hands-on expertise with cloud-native solutions from Google or AWS Solid application design, coding, testing, maintenance, and debugging skills and strong experience with Java 8/J2EE distributed application development, REST, and domain model Microservices, Spring Boot, API gateway, etc. Proven abilities in delivering CI/CD development methodologies Experience with modern development tools (ideally IntelliJ, Git, Maven, CI servers, Confluence (or other wikis), JIRA (or other trackers), code review tools, SCA tools) Knowledge of event sourcing and distributed message systems like using Apache Kafka Knowledge of Domain Driven Design concepts and designing and developing Microservices from Monolith architecture Experience in event-driven design of Microservices and 12-factor app development standards Expert knowledge of Spring ecosystem (Spring Boot, Spring Cloud, Spring Integration, Spring Cloud Data Flow, etc) API design and implementation (remote vs local APIs, routing and reverse proxying, load balancing, optimization techniques) Experience with developing within a Cloud environment must have good knowledge of cloud infrastructure including AWS Knowledge of developing Spring Data access application with AWS RDS or NoSQL data stores ,
Keyskills :
javamysqljsphibernatespringdataflowspringbootcodereviewspringdataapachecamelapachekafkaloadbalancingdevelopmenttoolsspringintegrationapplicationdesignntelligentnetwapplicationdev