hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Client Services Development Leader

6.00 to 11.00 Years   Mumbai City   24 Jul, 2019
Job LocationMumbai City
EducationNot Mentioned
SalaryNot Disclosed
IndustryRecruitment Services
Functional AreaGeneral / Other Software
EmploymentTypeFull-time

Job Description

Experience6 15 years including at least 3 years leading peoplePrefer Tier 1 capital markets experience. The candidate can come from a well regarded global company in an industry where technology is critical toResponsibilityContribute thought leadership insight to design a new trading and risk management platform.Co accountable for execution of a new form of fundamentally cross asset class trading platform which will include innovative new forms of risk analytics.Drive financial results for us by making our clients successful, and which enables opportunity for our people.MetricsUltimate responsibility for developing multiple front office trading applications across multiple release cycles.Created quantitatively oriented analytic software including translating business needs into specific algorithms.Created predictive models.Managed at least 8 people for at least 3 years.Evidence of new invention, innovation, or achieving competitive edge through technology.TechnologyStrong with high performance Java. Should have strong experience with languages such as Python or R, and understanding of to C . Exposure to Scala or Clojure is positive. Experience with SAS, SPSS, or Matlab is positive.Data science experience with algorithmsMachine learning understanding sufficient to mentor junior team member on core concepts.Exposure to applying analytics to high volumes of streaming data.Experience applying, or at a minimum understanding concepts, in big data packages such as Hadoop, Spark, and Storm.Prefer expertise with SQL Server, but can be experienced with any major database. They should know how to optimize query and database performance, and guide where to use relational stores relative other data management options.Understand the relationship of infrastructure to software performance, and able to guide infrastructure decisions to achieve high degrees of scalability with low latency.Should have certifications earlier in their career.ProcessShould bring experience with CRISP DM methodology for predictive analytics.Domain expertiseStrong preference for capital markets understanding such as attributes and behaviors of asset classes including fx, options, spread bets, binaries, and contracts for difference. For example, an ideal candidate will have built valuation, hedging, or alpha generating proprietary trading models.AttributesEducational background should include graduate or post graduate training in a quantitative subject from a competitive school. This requirement can be waived if a candidate has a clear and sustained record of designing, building, and operating predictive models, complex quantitative analytics, or machine learning in production in application (s) that are significantly material to the business results of a global company.Experience working in other global financial centers, such as London or New York, is positive.We value intelligence; self sufficient drive to reliably perform high quality tasks with minimal direction; and integrity to treat people well, do what they say, and contribute to a culture based on trust.,

Keyskills :
javaagiledeliveryunctionalriskmanagementmachinelearningdatasciencethoughtleadershipfinancialresultsbigdatacustomerrelationsdatamanagementfrontofficecapitalmarketssqlserverriskanalytics

Client Services Development Leader Related Jobs

© 2019 Hireejobs All Rights Reserved