Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Mumbai City |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | Recruitment Services |
Functional Area | General / Other Software |
EmploymentType | Full-time |
Skills C, C , Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial Services Capital markets, Derivatives Roles and Responsibility Analyze business requirement then design and developed datamart objects To deliver lsquoReport Cataloguersquo Reporting architecture design solution for a Murex reporting Analyze and optimize the feeders Assisted to perform Technical and Database migration of Murex binary release. ,
Keyskills :
documentationbusinessrequirementscapitalmarketsfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetaspjspjavaustomerrelationsrequirementsfunctionalaspnetquantitativemanagementdot