| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
| Ajax Jobs |
| Designing Jobs |
| ASP .NET Jobs |
| Java Jobs |
| MySQL Jobs |
| Sap hr Jobs |
| Software Testing Jobs |
| Html Jobs |
| Job Location | Mumbai City |
| Education | Not Mentioned |
| Salary | Rs 4.0 - 5 Lakh/Yr |
| Industry | nimation |
| Functional Area | Web / Mobile Technologies |
| EmploymentType | Full-time |
Responsibilities1) Development of server-side logic using both Magento 1 & Magento 2 MVC Structure e.g. development of Themes and Plugins or customization of existing/purchased Themes or Plugins to meet the client needs. Integrating 3rd party Themes and Plugins. 2) Maintenance of the database and Code files to make the site secure ensuring high performance and responsiveness to requests from the front-end User Interface (UI). 3) Migrating WordPress database from one domain to another domain. 4) Integration of the front-end elements built by the frontend developers into the application. Development of jQuery / JavaScript logic to meet the design and UI/UX needs. Frontend UI to backend communication using Ajax and various JavaScript frameworks. 5) Time Frame estimation and accuracy provided to the business analysts. Ensuring all work is delivered in the allocated time frame / sprint. Contributing to daily stand-ups and management updates. 6) Maintaining accuracy of data entered into Project Scope and Reports, Proper confluence and documentation. 7) Create, test and implement new features and tools in our architecture that will create automation and efficiency. 8) Assisting the Quality Assurance team with acceptance cases and testing. 9) Share your work / Knowledge and train other developers to improve overall quality and delivery.Required Skills1) Commitment to best practices. We want your opinions on operational processes, deployment checklists, and more. 2) Methodological & Modular development skills for Project & Code Version control accuracy. 3) Incident reporting accuracy and debugging abilities. 4) 2+ years of developing Website and Web-applications with object-oriented Programming skills in PHP, MySQL and other necessary programming languages.5) 2+ years working with MySQL, optimization, indexes and performance techniques. 6) 2+ years coding to high performance standards with WordPress Framework 7) Extensive knowledge about APIs. You can design Web services (REST, SOAP, WSDL) and integrate with other data providers, and you know when to use JSON or XML. 8) A solid understanding of networking and core Internet protocols (e.g. TCP/IP, DNS, SMTP, HTTP, and distributed networks). 9) Understand the importance of performance in web development and resolving Website and Server performance issues.
Keyskills :
jquerymvcwebreportscssjavascripttestingmysqldesignnetworkingmanagementajaxphpwordpressframeworkxmlhpdeveloperservices