hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Sr. Manager/DGM - Corporate Affairs Pharma Co.- Mumbai

5.00 to 10.00 Years   Mumbai City   06 Nov, 2020
HRDHouse
Job LocationMumbai City
EducationNot Mentioned
SalaryNot Disclosed
IndustryPharma / Biotech
Functional AreaGeneral / Other Software
EmploymentTypeFull-time

Job Description

Roles and ResponsibilitiesThe candidate will be based at the Corporate office of the Pharma Company in Mumbai and supporting the various projects of the Group Companies.You will be responsible for handling the following activities:

  • Banana Fibre Project development with TN government Interact with TN planning commission members and other authorities in the state to establish our banana fibre project in Tamil Nadu, that includes identifying potential raw fibre suppliers, selecting location for setting-up plant, organize civil and ETP consultant and develop property for the purpose.
  • Also look for other states like Karnataka, AP-Telengana, Gujarat, and countries such as Uganda and Philippines
  • Branding & Marketing: Coordination with brand agency for Banana fibre branding & website development
  • Identifying and establishing connection with potential influencer / buyer for banana fibre in the world
  • Banana Fibre Project to be set-up in Maharashtra.: Preparation and coordination for developing detailed project report on banana fibre project to be set-up in Maharashtra.
  • Coordination with civil / ETP consultants to set-up banana fibre project in the state of Maharashtra.
  • Enzyme Production Project: Preparation and coordination for developing strategic document for project Enzyme Production.
  • Identify the market opportunities for Enzymes in India and international
  • Interact with IT education team to design and implementation of Dynamic Progress Monitoring system
  • Corporate Affairs: Liaisoning with PR agencies and other external agencies in the form of meetings/letters/ presentations etc.
  • Interaction with Industry Associations for corporate inputs. Maintain relationship with industry bodies.
  • Business Development Activities: Interaction with various Universities/Institutions for prospecting new products and development.
  • Coordination with several scientists and technologists for development products and business prospects.
  • Zimbabwe Consulate works: Support function to the Office of the Hon. Consul of Zimbabwe, which includes attending consul meetings, interactions with Consul officials, exploring business opportunities with Zimbabwe Government.
  • Assist Foundation staff particularly in the area of CSR award application and related functions.
Desired Candidate ProfileAny Graduate, MBA in Operations, having 7-10 years of experience in handling Corporate Affairs, Regulatory Affairs, Government Affairs, with functional abilities in liasioning with internal and external bodies.Candidate staying in the Western Suburbs will be preferredYou should have good coordination skillsPerks and Benefits,

Keyskills :
fibremarket opportunitiesetpdetailed project reportcorporate affairstamilpharmaagencycivilexternal agenciesregulatory affairsgovernment affairsproject developmentbrandprogress monitoringdesignbranding identity marketingcsr

APPLY NOW

Sr. Manager/DGM - Corporate Affairs Pharma Co.- Mumbai Related Jobs

© 2019 Hireejobs All Rights Reserved