hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Back Office Executive Data Entry

1.00 to 6.00 Years   Navi Mumbai   04 Apr, 2019
Genesis Manpower Services
Job LocationNavi Mumbai
EducationNot Mentioned
SalaryRs 1.0 - 4.0 Lakh/Yr
Industryanking / Financial Services
Functional AreaBack Office OperationsData Entry
EmploymentTypeFull-time

Job Description

We have urgent requirement for Back Office Executive in Mumbai.

  • Back Office in Bank - Only MALE can apply.
Job Location Andheri Or Malad (Job location can be any)Salary 10k to 15k (depends upon your exp)It will be of 1 Year Contract (Job is permanent for long term - but candidate cannot leave company before 1 year)This opening is for Banking into backOffice domain based at Andheri West/Malad West.Requirement Should be aware of Advance Excel, VLookUP, HLookUP, Computer.Candidate should be GRADUATE Mandatory.Technical round will be conducted at a time of Interview:-V Look UP or H Look UPColoum AddingExcel extra sheet addingSheet 1 data - copying into sheet 2Typing Speed min 30 WPM
  • Back Office cum Telecalling (Inbound) Blended Process- Only FEMALE can apply.
Job Location Azad Nagar, Andheri WestSalary 15k to 20kThis opening is for Media Company based at Andheri West.RequirementMinimum 1yr Max 3yrs experienced.
  • Excellent Excel knowledge V- Lookup, pivot table, H-Look up.
  • Sourcing Data from Search Engines- Generating leads for sales team
  • Maintaining and preparing different MIS of Calls.
  • Inbound Calls- (No Sale, NO Target, No Outbound)
  1. A) Attending Incoming Calls, Tele-Calling Activity, Appointment Fixation -for Sales Coordinations.
  2. B) Email- Working on Data Base.
data entry on daily basis with MS Excel.created customer contact letters and maintained sales account information with MS word and MS Excel.generated reports from Oracle databases.If interested, kindly forward me your updated resume on: hrdep@genesismanpower.net Or Call me at- 9004414461(Contact between:Mon to Fri - 11 AM to 6 PMSat 11 AM to 3 PMRegards,Imran ShaikhManager - Human Resources9004414461 - hrdep@genesismanpower.net

Keyskills :
bankingerpmailmscitwpmtypingtallymisdatabasesackofficeexcelpivottableadvancemswordcomputercoursemsofficemisexecutivebackofficehlookupemailvlookupentrymsexcelbackendemailworkdatadataprocessingvlookupblendedhlookup30wpm

APPLY NOW

Back Office Executive Data Entry Related Jobs

© 2019 Hireejobs All Rights Reserved