hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Crash Analyst

4.00 to 7.00 Years   Pune   15 Sep, 2020
Job LocationPune
EducationNot Mentioned
SalaryNot Disclosed
IndustryPrinting / Packaging
Functional AreaGeneral / Other Software,Sales / BD
EmploymentTypeFull-time

Job Description

A leading company in Pune is looking for Crash Analyst on urgent basis.

Qualification: BE, MTech Mechanical/Automotive

Experience Min 4 years in Automotive

Job type Full time onsite

Software - LS - Dyna, Hypermesh and NASTRAN

Job Details -

a. Min. 4 years of experience in automotive CAE domain

b. Should be well conversant with analysis tool LS - Dyna and Hypermesh

c. Minimum 2 years experience in analysis.

d. Should have knowledge on Interior safety and regulations like FMVSS 201, ECE R21, Knee impact

e. . Min 4 years experience required.

Salary as per industry standards.

About Guest/blogger Guest/blogger posts belongs to respective authors. The articles/tips are summarized here, if interested in reading the complete blog post, please follow the links given under each post. ,

Keyskills :
cad camcadcamdynakneefmvsssalarynastransoftwareanalysishypermeshmechanicalautomotiveregulationsSolid ModelingDesign EngineeringSheet MetalSteel DetailingcaePDM

Crash Analyst Related Jobs

© 2019 Hireejobs All Rights Reserved