Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Pune |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | Printing / Packaging |
Functional Area | General / Other Software |
EmploymentType | Full-time |
A leading company in Pune is looking for Crash Analyst on urgent basis.
Qualification: BE, MTech Mechanical/Automotive
Experience Min 4 years in Automotive
Job type Full time onsite
Software - LS - Dyna, Hypermesh and NASTRAN
Job Details -
a. Min. 4 years of experience in automotive CAE domain
b. Should be well conversant with analysis tool LS - Dyna and Hypermesh
c. Minimum 2 years experience in analysis.
d. Should have knowledge on Interior safety and regulations like FMVSS 201, ECE R21, Knee impact
e. . Min 4 years experience required.
Salary as per industry standards.
About Guest/blogger Guest/blogger posts belongs to respective authors. The articles/tips are summarized here, if interested in reading the complete blog post, please follow the links given under each post. ,Keyskills :
cad camcadcamdynakneefmvsssalarynastransoftwareanalysishypermeshmechanicalautomotiveregulationsSolid ModelingDesign EngineeringSheet MetalSteel DetailingcaePDM