analysis abilities jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

analysis abilities Job Openings

Showing 36851 - 36900 of 38170 Jobs

Java Developer

Quess Corp (Magna Infotech) 3.00 to 5.00 Years Mumbai City 22 Sep, 2023

Tech Mahindra- Hiring for backoffice into banking process

Tech Mahindra Ltd 0.00 to 4.00 Years Mumbai City 22 Sep, 2023

Work Location: Chandivali, Mumbai

req. for Application Architect Mobile

IBM India Pvt Limited 12.00 to 16.00 Years Mumbai City 22 Sep, 2023

strong communication skills

mobile application development

life cycle

objective c

design thinking

Sr. Manager - Medical Services

LUPIN 5.00 to 10.00 Years Mumbai City 22 Sep, 2023

Qualification

Revant Experience:

Key Responsibilities:

Market Requirements Documents

Product Requirements

Consumer Electronics

medical

SW Project Manager 2023

Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Coordinate internal resources and third parties/vendors for the flawless execution of projects
Ensure that all projects are delivered on-time, within scope and wi...
deliveryproject managementcustomer relationsreportingjavaproject plansrisk management

apply now Vehicle Computer- Functional Safety Engineer

Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Mandatory skills:

Very Good understanding of ISO 26262 safety dev process
Hand-on experience of working on Microprocessor domain
Good ...
safetyfirst aidinspectionsiterisk assessmentsoftware engineeringprogramming languagestechnical documentationautomotive locksmithingagile scrum

Senior System Engineer

Merck Ltd 4.00 to 9.00 Years Bangalore 22 Sep, 2023

Research & Development Scientist

QUISCON BIOTECH 0.00 to 1.00 Years Bangalore 22 Sep, 2023

electronic data capture

research administration

operations

KEY ACCOUNT MANAGER BANGLORE

VP ASSOCIATES Hiring For Maini Precision Products 5.00 to 10.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra

key account management

key accounts

Key account manager Bangalore

VP ASSOCIATES Hiring For Maini Precision Products 5.00 to 10.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra

key accounts

business development

KEY ACCOUNT MANAGER

VP ASSOCIATES Hiring For Maini Precision Products 3.00 to 7.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra

key accounts

business development

Property consultant Bangalore

TRIDENT INFOSOL PVT LTD 1.00 to 5.00 Years Bangalore 22 Sep, 2023

property matters

property management

property acquisition

Property Consultant Bangalore

TRIDENT INFOSOL PVT LTD 1.00 to 5.00 Years Bangalore 22 Sep, 2023

property matters

property management

property acquisition

Workday Technical Consultant

LTIMindtree Limited 5.00 to 8.00 Years Bangalore 22 Sep, 2023

Must have hands-on experience in Advanced Compensation and Talent Management modules
Assist with maintenance and configuration of existing Workday Core HCM application

workdaytechnicalcore hcm

Faculty - Law

Garima Interprises Hiring For Garima Interprises 5.00 to 10.00 Years Bangalore 22 Sep, 2023

Professor Job Description Template We are looking for a well-organized, resourceful professor to join our excellent faculty. The professors responsibi...
legal researchconstitutional lawfamily lawintellectual propertyethicsproperty lawlegal issuessyllabuslegal studies

Backend Executive / Data Entry

Fondstaff Private Limited 0.00 to 4.00 Years Bangalore 22 Sep, 2023

Job description Good in Advance Excel, Vlook up, Hlook up, Pivat Table Maintaining Mis of Data Collation ,Compilation Analysis Data and provide data for sales forecast. Required Cand...
back officedata entry work from homedata analysisdata entrydata entry typingmismis operationsback office operationswork from home typing

Urgent Hiring for Diploma Mechanical Engineer
Genius Consultants Limited Hiring For 3M India Fresher Bangalore 22 Sep, 2023

Freshers with Diploma Mechanical Engineering Degree. Role: Mechanical Engineer Diploma fresher Required Job type: Fresher Salary: 12k -16K(Take home) Mechanical Engineer are Responsible for ...
cadcommunication skillsoptimizationtime managementdata analysisnew product developmentmathtechnical knowledgeteam work

Customer Value Management Bangalore
ARCHISHTECH SOLUTIONS (OPC) PRIVATE LIMITED 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Create and manage CVM campaigns

Perform customer behaviour analysis and create, execute and monitor marketing campaigns for retention, churn and cross sell

Regularly ...
banking productsinsurance salesemibanking processbankingcommunication skillsstrong analytical skillstelecalling

Accounts payable in Bangalore
GETTJOBS Recruitment Firm Hiring For Accounts payable 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Hi Greetings from Gettjobs Openings foraccounts payable JD for Payable- CAT 1. Category Invoice processing for all segments - Ensuring Compliance TDS/GST /MSME/LTDS etc and ...
audit managementratio analysisreconciliationaccounts payablegstauditcataccountstds working

Sponsorship Sales Media Industry Bangalore
Morpheus Human Consulting Pvt Ltd 3.00 to 8.00 Years Bangalore 22 Sep, 2023

Job Title: Sponsorship Sales Media Industry Bangalore The key responsibility of the role entails conceptualising and launching conference IPs in identified industry...
relationship managementbusiness developmentsales

Bus. Intelligence Engineer, ISCAP - Var
Amazon 2.00 to 4.00 Years Bangalore 22 Sep, 2023

Amazon Web Services (AWS) provides a highly reliable, scalable, and low-cost cloud platform that powers thousands of businesses in over 190 countries. AWS Infrastructure Supply Chain & Procurement...
amazon web serviceshandle multiple projectsexploratory data analysisdata centersql queriestime seriessupply chainweb servicesrapid growthdata analysisdata modelingmodel buildingbusiness acumencommercial modelsinterpreting databusiness analy

Technical Lead Associate
Cognizant 2.00 to 0.00 Years Bangalore 22 Sep, 2023

Technical Lead Qualification: Bachelors in science , engineering or equivalent Responsibility: Requirement Understanding and Analys...
test datatest management tooltest cases

Urgent looking for Business Systems Analyst - SOX Compliance
Cisco Systems, Inc 3.00 to 7.00 Years Bangalore 22 Sep, 2023

What Youll Do You will be part of the Finance IT organization s SOX Control Execution Team that helps ensure Cisco has a strong internal control environment and is SOX Compliant. You will be wo...
it general controlsservice delivery managementoffice 365

Branch Credit Manager
AV Global Advisory Services 2.00 to 6.00 Years Vishakhapatnam 14 Sep, 2023

Urgent Vacancy with Leading NBFC Role - Branch Credit Manager Location - Delhi, Jaipur, Kota, Udaipur, Bhopal, Indore, Jabalpur, UP, Salem, Trichy, Hyderabad, Vizag Job Description

...
creditcredit analyst

Require for District Entreprenureship Lead
Foursis Technical Solution 2.00 to 5.00 Years Vadodara 14 Sep, 2023

Job functions area : Sales / Business Development Location : Vadodara Experience : 2 - 5 years Skills : DISTRIBUTOR, BU...
lead generationbusiness analysisbusiness developmentsalesbusinessanalysisdistributionDemand Generation

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

looking for Practice Head- Vadodara
MNR Solutions Pvt Ltd 15.00 to 17.00 Years Vadodara 14 Sep, 2023

Job profile- Practice Head Experience 15+ years Location- Chennai / Bangalore/ Vadodara Qualification- Bachelors / Masters degree in engineering Job Location- Chennai/ Bangalore/ Vadodara Benef...
consultancy servicesmfg-pro

Sales Development Manager A
The H R Friend 1.00 to 6.00 Years Vadodara 14 Sep, 2023

Sales Development Manager (SDM) Department:Agency Channel Company:(For- Indias Leading Life Insurance Company) Role and Responsibili...
field workfield salessalesfmcg salesbanking salesinsuranceagency channelbfsi salesfinance

Immediate Opening for Backend Executive / BPO Process
Fondstaff Private Limited 0.00 to 4.00 Years Pune 14 Sep, 2023

Responsibilities:

Input and update data from various sources into computer systems and databases

Verify accuracy and completeness of data entries
graduatebackendback officenon voice processbackend supportbpocommunication skills

CONTRACT TO HIRE - PAM+ CyberArk consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Pune 14 Sep, 2023

Skill: CyberArk+PAM Positions: 10 Location:Hyderabad/ Bangalore/ Noida/Chennai/Gurgaon/Pune/ Kolkata Experience 3- 7 Years Work Mode: Hybrid Need to work from office Professional Qualification...
cyberarkiampam

Industry Manager
KBESHA SOLUTION Hiring For Manufacturing company 10.00 to 15.00 Years Pune 14 Sep, 2023

Dear Candidate, Greetings fromKBESHA solution, We are hiring for our esteemed organization. Presently we needIndustry manager. Essential Job Function...
communicationcommercialproduct knowledgenegotiationexperience in direct sales of industrial producteffective

Senior Specialist, Scrum Master / Agile Delivery Lead
TALENTSTACK CONSULTING PRIVATE LIMITED 10.00 to 20.00 Years Pune 14 Sep, 2023

Designation / Position Senior Specialist, Scrum Master / Agile Delivery Lead

Job Description (Minimum 250 characters)* Job description The Scrum Maste...
scrum masteragile leadership

HIRING FOR Mechanical Design Engineer
Manpower Solution Fresher Pune 14 Sep, 2023

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Sales Development Manager (A1)
The H R Friend 1.00 to 6.00 Years Pune 14 Sep, 2023

Sales Development Manager (SDM) Department:Agency Channel Company:(For- Indias Leading Life Insurance Company) Role and Responsibili...
salesfield saleslife insurancefield workbfsi salesbanking salesfmcg salesinsurancefinance

BACK OFFICE EXECUTIVE PUNE
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Pune 14 Sep, 2023

Back Office Executive Responsibilities:

back officeinventory controlresearch analysismarket researchback office operations

GDC BI Developer
FERVOUR INFOSYSTEM PRIVATE LIMITED 8.00 to 11.00 Years Pune 14 Sep, 2023

define scope and methodology for dashboards and reports creation, participation in design phase for reports and dashboards Build the reporting data model and help the data engineering team with c...
bi toolstableau

Java Developer Pune
DC Consultants 3.00 to 6.00 Years Pune 14 Sep, 2023

Job description

Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system....
javascriptjqueryhibernate

Activities Director
Garima Interprises Hiring For Garima Interprises 5.00 to 7.00 Years Pune 14 Sep, 2023

Activities directors plan events that take place during leisure time. Though activities directors may conduct their duties across a multitude of environments, most work in facilities that house a...
communication skillscustomer serviceinternational call centerinterpersonal skillsmanagementmulti-tasking

BACK OFFICE EXECUTIVE NAGPUR
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Nagpur 14 Sep, 2023

Back Office Executive Responsibilities:

back officeadministration workresearch analysisback office operationsmarket research

Senior Specialist, Scrum Master / Agile Delivery Lead
TALENTSTACK CONSULTING PRIVATE LIMITED 10.00 to 20.00 Years Noida 14 Sep, 2023

Designation / Position Senior Specialist, Scrum Master / Agile Delivery Lead

Job Description (Minimum 250 characters)* Job description The Scrum Maste...
scrum masteragile leadership

POSH MANAGER
Ara Resources Private Limited 10.00 to 15.00 Years Noida 14 Sep, 2023

Job Description Form Division / Department : LAW/ER Location of Posting : Open Job Title : POSH Manager Reporting To: (Designation) Sr Manager Type of Position: (Fulltime/ Part time/Contract...
employment lawer policiesposh

Activities Director
Garima Interprises Hiring For Garima Interprises 5.00 to 7.00 Years Noida 14 Sep, 2023

Activities directors plan events that take place during leisure time. Though activities directors may conduct their duties across a multitude of environments, most work in facilities that house a...
communication skillscustomer serviceinternational call centerinterpersonal skillsmanagementmulti-tasking

Sales Development Manager (Bancassurance)1
The H R Friend 1.00 to 6.00 Years Noida 14 Sep, 2023

Company:Indias Leading Life Insurance Company Designation:Sales DevelopmentManager(SDM) Department:Bancassurance (Banca...
cross sellinglife insurancebfsi salescredit card salesbancassurancebanking salesbancabranch bankinginsurance

Corporate Agency Manager (Bancassurance)40
The H R Friend 1.00 to 6.00 Years Mangalore 14 Sep, 2023

Company: Indias Leading Life Insurance Company Designation: Corporate Agency Manager (CAM) Department:Bancassurance (Banca Ch...
bankinginsurancelife insurancemutual fundsbancabancassurancecasa salesbfsicross selling

Sales Development Manager (A1)
The H R Friend 1.00 to 6.00 Years Mumbai City 14 Sep, 2023

Sales Development Manager (SDM) Department:Agency Channel Company:(For- Indias Leading Life Insurance Company) Role and Responsibili...
salesfield saleslife insurancefield workbfsi salesbanking salesfmcg salesinsurancefinance

Dispatch Officer
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Mumbai City 14 Sep, 2023

Urgent Hiring For Dispatch Officer Profile. Experience 3-4 years experienced. CTC ( 3 LPA Fixed + 1.8 LPA incentives) Qualification warehouse managementlogistics operationssupply chain

Social Media executive Thane
Maargeen Consultancy Private Limited 2.00 to 4.00 Years Thane 14 Sep, 2023

Social Media Executive Designation: - Social Media Executive Location : Mulund Job description Business Research Industry research, Understanding client brief, Competitor analysis. Strategy ...
business researchstrategy development

Factory Operations executive
Maargeen Consultancy Private Limited 1.00 to 6.00 Years Navi Mumbai 14 Sep, 2023

Designation: Factory Operations Executive Job description

Handle orders in hand and plan the timelines to meet orders in time

Manpower planning and capacity

Man...
manpower utilizationmanpower planningcapacity analysismanpower handling

Personal Assistant
Maargeen Consultancy Private Limited 2.00 to 4.00 Years Thane 14 Sep, 2023

Maargeen was born to fulfil a void in the corporate world. With a strong base of mentoring young qualified professionals for the corporate world, Maargeen has the advantage of providing the most ...
meeting managementpersonal assistanceproblem solving

Accounts and Finance Manager
Maargeen Consultancy Private Limited 1.00 to 3.00 Years Thane 14 Sep, 2023

Maargeen was born to fulfil a void in the corporate world. With a strong base of mentoring young qualified professionals for the corporate world, Maargeen has the advantage of providing the most ...
chartered accountancyfinance

PREV
NEXT

analysis abilities Job Openings

Professor Job Description Template We are looking for a well-organized, resourceful professor to join our excellent faculty. The professors responsibi... legal researchconstitutional lawfamily lawintellectual propertyethicsproperty lawlegal issuessyllabuslegal studies

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin... mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Job description Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system.... javascriptjqueryhibernate

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Professor Job Description Template We are looking for a well-organized, resourceful professor to join our excellent faculty. The professors responsibi...
legal researchconstitutional lawfamily lawintellectual propertyethicsproperty lawlegal issuessyllabuslegal studies

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Job description

Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system....
javascriptjqueryhibernate