Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
We are looking for a passionate UX/UI Director responsible for creating best in class products and solutions for the fintech space, one who enjoys creating experiences with technology, hacking on new ...
front enduser flowsnew projectsuser researchinteraction designstrategic initiativesinformation architectureiosivradarcsbfsihtml5axuredesignmobileandroidhacking
Risevertise Media is a design studio that enables brands to communicate stories and create exceptional user experiences. Through strategic insights and tailored design solutions, we collaborate with p...
usabilitycss3wireframesaxureprototypehtml 5user experiencejava scriptbalsamiqPrimary Responsibilities Designs and improves software programs by:
Gender : Male/Female Industry : IT Job Role & Responsibilities: Manual/Selenium testing of Android Applications, iOS Applications, Responsible Websites, and Enterprise Cloud based Web Portals Deve...
test casesregression testingautomationreportingsoftware quality assurancetest datatest scriptssecurity testingsoftware qualityquality assuranceanalytical skillsGender : Male/Female Industry : IT Job Role & Responsibilities: Manual/Selenium testing of Android Applications, iOS Applications, Responsible Websites, and Enterprise Cloud based Web Portals Deve...
test casesregression testingautomationinternet of thingstest datatest scriptsproblem solvingsoftware testingdatabase testingsecurity testingsoftware qualityquality assuranceSummary of Job
A revolution is brewing, and Absolutdata is the epicentre of the revolution called Big Data - A megatrend impacting every facet of business decision making....
salesmanagementmiscustomer relationsqualitysoftware development life cyclebig dataaxure rpfront endlife cycleweb servicesunit testinguser experiencemachine learningcoding standardsagile methodologydefect managementunstructured dataprojec
Experience: 10- 12 years
A senior/lead front-end web developer is responsible for implementing visual elements that users see and interact with in a web application.
They are suppo...
salesbusiness developmentconsultingcustomer relationsdeliverysoftware development life cycleaxure rpfront endlife cycleweb servicesunit testinguser experiencecoding standardsagile methodologydefect managementproject managementproduct develDiscus a spec with the Product Manager. Understand the problem being solved. Question why a certain approach is being taken. Bring a fresh perspective to the table. Convince, or get convinced. Wirefr...
csshtmldesignphotoshopwireframingcopywritingfitaxurelabelsdiscusoptionsinkscapeanalyticalillustratux designer in chennai
* Duties and Responsibilities - WHY THIS POSITION IS REQUIRED Our footprint is growing manifolds and the points of interaction with the customer are multiplying. We need to ensure that we create highl...
bankingfinancefilingmissimplifying the complexvisual designdigital assetsinteraction designquality orientationperformance metricssoftware developmentagileaxuredesignmobilebalancemetricsadobe* About Standard Chartered We are a leading international bank focused on helping people and companies prosper across Asia, Africa and the Middle East. To us, good performance is about much m...
sqldata analysismicrosoft excelcustomer relationsreportingcorporate social responsibilityms officeoffice appsuser storiesdeep learninguser trainingtest scenariosDigital Business Analyst + Scrum master Requirements: As a Business Analyst you will be responsible for managing and delivering innovative solutions to the clients....
use casesuser storiesasset managementbusiness analysiscustomer researchcustomer journeyssqlnonfunctional requirementsResponsibilities: Design beautiful web art mockups (Desktop and Mobile) Coordinate projects independently and work directly with clients Design supplementary marketing materials (email templates...
documentationlogisticsshippingchasalesbranding identity marketingadobe photoshopuser experiencecommunication skillsstatements of work sowwritten communicatiomarketing materialstime managementsocial mediaAbout KOKO Networks KOKO Networks is a venture-backed technology company currently operating in Kenya and India. Our mission is to imagine and deliver technology that transforms life in the world s f...
designmass marketadobe photoshopautocadproduct designcost savingstake orderscontinuous improvement facilitationuser researchvisual designconsumer good
We are looking for a UI/UX Designer with good knowledge of designing interfaces for mobile and web Applications. Somebody who is passionate about resolving user pain points through great design wi...
customer relationsresearchdesignuser flowssocial mediauser researchweb applicationstrategic designwork effectivelygraphic designingagile developmentheuristic analysisioshtml5agilehpuxab testingusercentered design Roles and Responsibilities:
1.Understand product specifications and user psychology.
2.Conduct concept and usability testing and gather feedback.
3.Create personas thr...
Job Description - User Experience Designer for an Education Technology Product We are looking for a passionate UX expert for Splash Math. The ideal candidate would be competent in all facets of the ...
customer relationsresearchdesignuser experience designuser flowsrapid growthuser researchmental modelsuser experienceproduct offeringssoftware engineershpuxking with childrenphotographic memJob Summary: The Product Manager II will own one or more product features and lead project execution. He/she will own product development plans and represent their feature(s) within the cross-function...
product marketingproduct discoveryproduct visionmarket analysisproduct strategyovercome obstaclesmusic makingstatements of work sowJob Description AVASOFT is looking for a Sr. User Experience (UX) Design Consultant to help scale our capability to deliver an enhanced experience to our customers. As an UX Design Consultant, you wi...
ux designheuristic analysisrapid prototypingframer miroux softwaresketchtesting a/b testinginvisionbalsamiqucdJob Description AVASOFT is looking for a Sr. User Experience (UX) Design Consultant to help scale our capability to deliver an enhanced experience to our customers. As an UX Design Consultant, you wi...
ux designheuristic analysisrapid prototypingframer miroux softwaresketchtesting a/b testinginvisionbalsamiqucdJob Description AVASOFT is looking for a Sr. User Experience (UX) Design Consultant to help scale our capability to deliver an enhanced experience to our customers. As an UX Design Consultant, you wi...
ux designheuristic analysisrapid prototypingframer miroux softwaresketchtesting a/b testinginvisionbalsamiqucd
Experience: 10- 12 years
A senior/lead front-end web developer is responsible for implementing visual elements that users see and interact with in a web application.
They are suppo...
salesbusiness developmentconsultingcustomer relationsdeliverysoftware development life cycleaxure rpfront endlife cycleweb servicesunit testinguser experiencecoding standardsagile methodologydefect managementproject managementproduct develSummary of Job
A revolution is brewing, and Absolutdata is the epicentre of the revolution called Big Data - A megatrend impacting every facet of business decision making....
salesmanagementmiscustomer relationsqualitysoftware development life cyclebig dataaxure rpfront endlife cycleweb servicesunit testinguser experiencemachine learningcoding standardsagile methodologydefect managementunstructured dataprojecThe Informatica User Experience (UX) team propels the design and usability of a broad spectrum of data-integration and data-management products. We are a globally diverse, world-class group of designe...
advertisinginsurancenationalportalsstudiobig datauser flowsdata qualitydata securityuser researchdesign briefsgraphic designdata managementFront End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5
This is a full time position (not a contract position) for an experienced Senior UI Developer . During this engagement you will work with clients and relevant...
jquerycssjavascripthtmlhtml 5adobe creative suiteon sitefront endcolor theorygrid systemsvisual designgraphic designuser experiencedesign patternssoftware designtime managementcomputer scienceweb applicationsstrategic designmobile platfResponsibilities: Design beautiful web art mockups (Desktop and Mobile) Coordinate projects independently and work directly with clients Design supplementary marketing materials (email templates...
documentationlogisticsshippingchasalesbranding identity marketingadobe photoshopuser experiencecommunication skillsstatements of work sowwritten communicatiomarketing materialstime managementsocial media* Duties and Responsibilities - WHY THIS POSITION IS REQUIRED Our footprint is growing manifolds and the points of interaction with the customer are multiplying. We need to ensure that we create highl...
bankingfinancefilingmissimplifying the complexvisual designdigital assetsinteraction designquality orientationperformance metricssoftware developmentagileaxuredesignmobilebalancemetricsadobeUI Designer EXPERIENCE REQUIRED: 2+ YEARS REQUIREMENTS: Two or more years of experience in HTML5, CSS3 and Bootstrap. Develop UI mockups and prototypes that clearly illustrate how sites function a...
css3adobe photoshophtmljquerycssfront endproblem solvinghtml5basicdesignmobilebannersoutlookmockupsphotoshopportfoliojavascriptdreamweaverWeb StandardsAbout KOKO Networks KOKO Networks is a venture-backed technology company currently operating in Kenya and India. Our mission is to imagine and deliver technology that transforms life in the world s f...
designmass marketadobe photoshopautocadproduct designcost savingstake orderscontinuous improvement facilitationuser researchvisual designconsumer goodHi, Please find Job Description below, Exp - 2-4 Years. Location : Bangalore Role name: UI / UX designer. - As...
user flowsdesign briefscreative directionbasicsketch appproject administrationmapslanding pagessite mapsdesign guidelinesdesignuser experiencedesign thinkinguser journeysadobe suiteemailnicegraspadobeResponsibilities: - Oversee all design projects, from conception to delivery. Design original pieces, including illustrations and infographics. Review junior designers work to...
customer relationsresearchdesignvisual artsimage editinggraphic designediting softwarebscbrandfontseditingsoftwareindesignmarketingphotoshopportfoliotypographyhpuxadobeAbout the role You will be a part of a tight-knit team of innovative folks, and as a UX designer you would be leading on all aspects of User Experience for product development projects across the org...
domain namesmail sortingcustomer relationsuse casesuser experienceonline servicescard sortinginteraction designresearchdesignquick turnaroundproduct developmentproduct portfoliomarket researchhpuxUI Developer - Job Description JPMorgan Chase is a leading global financial services firm with assets of $1.1 trillion and operations in more than 50 countries. The firm is a leader in investment ban...
jqueryinvestment bankingwealth managementhtmlhtml 5javascriptunstructured datafinancial servicesweb servicesreference datasupport managementcsscontent managementFront End Developer/ Designer Coding Skills Solid working knowledge in native Javascript and JS libraries such as JQuery/ UI, Dojo, Prototype, Kendo UI and CoffeeScript. Expert level knowledge in ...
jqueryzendhtmlbootstrapseojavascriptsassdojojsonphpcssconceptual designprint designemail marketingkendo uifront endgraphic designhtml 5
Take your next career step at ABB with a global team that is energizing the transformation of society and industry to achieve a more productive, sustainable future. At ABB, we have the clear ...
javacustomer relationslinuxautomationcorel drawuser flowsjquery mobileadobe photoshopsolution designcomputer scienceadobe illustratorproduct management
This is a full time position (not a contract position) for an experienced Senior UI Developer . During this engagement you will work with clients and relevant...
jquerycssjavascripthtmlhtml 5adobe creative suiteon sitefront endcolor theorygrid systemsvisual designgraphic designuser experiencedesign patternssoftware designtime managementcomputer scienceweb applicationsstrategic designmobile platfRoles and Responsibilities Educational Details:- Diploma/ graduation related to painting, multimedia Candidates from other streams with relevant work experience can also app...
html5data visualizationuser profilingvisual languagedesign supportpvcmobileportalcsscss3adobe photoshopwebsite managementaxuremanualvisual designdesigninformation mappingjqueryhtmlUI Developer - Job Description JPMorgan Chase is a leading global financial services firm with assets of $1.1 trillion and operations in more than 50 countries. The firm is a leader in investment ban...
web servicesxmltechnology architecturereference datadocument managementwealth managementsupport managementjqueryjavascriptcsshtml 5transaction processinghtml
Skills
Job Details Job Description Good experience in any of the following design tools Pencil, Axure, Visio, Balsamiq, IRise Creating wireframes, layouts, information design Usability reviews,...
customer relationsresearchdesignaxurevisioreviewsusabilityRoboHelpSnagItJoint Application DesignBusiness RequirementsSingle SourcingOnline HelpFrameMakerRelease NotesOnline Help DevelopmenthpuxAbout MoEngage MoEngage is a young, fast-paced workplace that fosters a culture of innovation, ownership, freedom, and fun while building tech products of the future...
marketingsalesproduct developmentproduct managementbias for actionsoftware product managementbig datauser researchcustomer datadata trackingproduct designdata management Roles and Responsibilities:
1.Understand product specifications and user psychology.
2.Conduct concept and usability testing and gather feedback.
3.Create personas thr...
Looking for a dynamic professional with sound experience as a leader in areas of Design, Content, UI/ UX, Digital Marketing Advertising, and Team Account Management. Have exposure working in Agile and...
adobe creative suitemobile application designaxure rpteam buildingadobe acrobatsocial designmarket researchteam managementemerging trendsmicrosoft officesecondary marketcard stingmail stingdigiRisevertise Media is a design studio that enables brands to communicate stories and create exceptional user experiences. Through strategic insights and tailored design solutions, we collaborate with p...
usabilitycss3wireframesaxureprototypehtml 5user experiencejava scriptbalsamiqJob Summary: The Product Manager I will own a product feature and lead project execution. He/she will own the development plan and represent their feature within the PM team and will have an internal ...
salesovercome obstaclesequipment supplyprocess improvementdeliveryproduct managementproduct marketingproduct developmentmarketingbusiness strategymusic making
© 2019 Hireejobs All Rights Reserved