Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Candidate Detail:
Title: Mid-level Java Full stack Developer (React) Location: Hyderabad/Bangalore Experience: 4-6 Years Required Candidate profile Strong Experience as a Full stack developer with Java, JS, ...
javacsspair programmingextreme programminghtml 5javascriptspringmysqldesigntest driven developmentcss3jqueryrspecdesign patternssoftware craftsmanshipbootstraphtmlatddbehaviordriven developmentdomaindriven designLooking for Java FullStack Developer with 4 to 6 years of experience Required Candidate profile Primary Skills: Angular 6+, RXJS, NGRX, Java, API, HTML, CSS3, Spring Framework Required Skills: ...
html 5angulartest driven developmentspringbootstrapjavacss3design patternsapimanagementatddrspecextreme programmingpair programmingdesignnunitsoftware craftsmanshiphtmlbehaviordriven developmentdomaindriven designLooking for Java Full stack Developer (React) with 4 to 6 years of experience. Required Candidate profile
About Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, w...
javajavascriptsqlcustomer relationshtmlspring bootunit testingevent driventesting toolsmessage brokerbusiness processdesign developmentsoftware engineeringprofessional servicesdomaindriven designAs a Software Developeradvanced to R&D department that worked on creating a tool that covers the 100% code reach ability without any defects. Also, have to implementing Test Driven Development methodo...
javamysqljsphibernatespringtest driven developmenttddhtmlreachsoftwarejavascriptPair ProgrammingRSpecSoftware CraftsmanshipBehaviorDriven DevelopmentDomainDriven DesignProficient development skills in PHP, Understanding of MVC design patterns, JavaScript, HTML5, and CSS3, MySQL Experience: 2+ Years Package: DOE Number of Vacancies: 1 Location: Innovation Hub, Ko...
javascriptcssjqueryhtmlmysqldesign patternsphphtml5designinnovationcss3Architectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlRefactingDomainDriven DesignTechnical Architect - Java ( SOLID / TDD / KISS / YAGNI / DRY ) Experience - 9+years | Job Location - Pune| CTC - upto 35 LPA Looking for candidates with the below mentioned prerequisites Hands on ...
javanetframeworkdeliverysql servertddctcdesignPair ProgrammingRSpecSoftware CraftsmanshipExtreme ProgrammingATDDNUnitRefactoringGratuityERTMSJoiningBehaviorDriven DevelopmentDomainDriven DesignNote : 3rd Party Payroll Number of post : 1 Gender : Male / Female Industry : IT Skills : Mandatory Skills : NodeJS Any Rest API framework (added advantage in case of Express JS or SailsJS) Re...
design patternsapiguiresttapemochadesigndockerexpresssourcingblueprintarchitectureArchitectural PatternsRefactoringSTLOOADSOLID PrinciplesMultithreadingNUnitDomainDriven DesignResponsibilities Create innovative applications for the Android mobiles and tablets Lead our Android development efforts Minimum Requirements Love beautiful Android apps Have profound experien...
androidjavajsonapicomtest driven developmentopen sourceandroid developmentgraspdesigntabletsmobilesfeaturesinterfacesinstrumentsconventionsPair ProgrammingBehaviDriven DevelopmentDomainDriven DesignQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioContent Writter - 04 Looking Yii Developer having Strong knowledge of PHP web frameworks Yii with Understanding of MVC design patterns object oriented PHP programming. Apply Now Location: Lucknow,...
design patternsphpyiidesignArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlCodeIgniterLaravelSymfonyYiiCakePHPRefactingDomainDriven DesignZend FramewPhpMyAd
Eligibility: Any graduate/Post graduate
Skills: Knowledge in other ecommerce platforms like Magento,woo - commerce, BigCommerce, Must have worked on 5 ...
Experience of 2 - 10 years in Product development
Position : Node Js Developer Experience : 1-3yrs -We are looking for a dynamic Node js developer for our tech team at Pune. Any one who holds almost 1+ years of experience in NODE ...
test driven developmentdata analyticssqlbasicpythondevopsmongodbanalyticsmonitoringPair ProgrammingRSpecSoftware CraftsmanshipExtreme ProgrammingDomainDriven Design
Must have 3+ years of hands-on experience in PHP Candidates must have 3+ years experience in Laravel, Yii2, PHP Frameworks. Knowledge of CMS like WordPress, Magento is an added advantage. Candidat...
test driven developmentfront endwordpress cmsweb developmentsoftware solutionsphpcmstestsmagentolaravelsoftwarewordpressmaintenanceperformanceintegrationarchitectureimplementationPair ProgrammingBehaviorDriven DevelopmentDomainDriven DeTechnical Architect - Java ( SOLID / TDD / KISS / YAGNI / DRY ) Experience - 9+years | Job Location - Pune| CTC - upto 35 LPA Looking for candidates with the below mentioned prerequisites Hands on ...
javanetframeworkdeliverysql servertddctcdesignPair ProgrammingRSpecSoftware CraftsmanshipExtreme ProgrammingATDDNUnitRefactoringGratuityERTMSJoiningBehaviorDriven DevelopmentDomainDriven DesignQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioWe are Healthcare Domain Startup in Bangalore (Silicon Valley of India). We are looking for a rock star NodeJs Developer for our tech team at Bangalore. Qualification: BE/B.Tech/MTech/ME/Phd Locati...
data analyticstest driven developmentsqlnosqlpair programminghealthcarebasicmonitoringanalyticschartmaxxmongodbpythondevopsdomaindriven designbehaviordriven developmentQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketio
Proficient development skills in PHP, Understanding of MVC design patterns, JavaScript, HTML5, and CSS3, MySQL Experience: 2+ Years Package: DOE Number of Vacancies: 1 Location: Innovation Hub, Ko...
javascriptcssjqueryhtmlmysqldesign patternsphphtml5designinnovationcss3Architectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlRefactingDomainDriven DesignQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioCandidate Detail:
Content Writter - 04 Looking Yii Developer having Strong knowledge of PHP web frameworks Yii with Understanding of MVC design patterns object oriented PHP programming. Apply Now Location: Lucknow,...
design patternsphpyiidesignArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlCodeIgniterLaravelSymfonyYiiCakePHPRefactingDomainDriven DesignZend FramewPhpMyAdStrong critical thinker with problem solving aptitude. Good written and oral communication skills Strong Java technical Expertise (Java 8+, Spring, Spring Boot) Hands-on experience on REST API o Re...
test driven developmentweb developmentproblem solvingoral communicationsqlormjavarestdesignspringdockersecurityanalysiscommunicationelasticsearchPair ProgrammingRSpecSoftware CraftsmanshipBehaviorDriven DevelopmentDomainDriven DesignStrong critical thinker with problem solving aptitude. Good written and oral communication skills Strong Java technical Expertise (Java 8+, Spring, Spring Boot) Hands-on experience on REST API o Re...
test driven developmentweb developmentproblem solvingoral communicationsqlormjavarestdesignspringdockersecurityanalysiscommunicationelasticsearchPair ProgrammingRSpecSoftware CraftsmanshipBehaviorDriven DevelopmentDomainDriven DesignA successful candidate should have worked in a startup- like environment with high levels of Ownership. Job Responsibilities Have excellent coding skills should be able to convert the design into co...
design patternscssgitdesignownershipjavascriptangularArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlHeuristic EvaluationRefactingDomainDriven DesignMobile DeWho we are looking forWe are looking for people who want to help us change the way companies think and approach problems; people who want to teach and learn from others; we are looking for people who ...
javacssGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioDomainDriven DesignAspectOriented ProgrammingNote : 3rd Party Payroll Number of post : 1 Gender : Male / Female Industry : IT Skills : Mandatory Skills : NodeJS Any Rest API framework (added advantage in case of Express JS or SailsJS) Re...
design patternsapiguiresttapemochadesigndockerexpresssourcingblueprintarchitectureArchitectural PatternsRefactoringSTLOOADSOLID PrinciplesMultithreadingNUnitDomainDriven DesignResponsibilities Create innovative applications for the Android mobiles and tablets Lead our Android development efforts Minimum Requirements Love beautiful Android apps Have profound experien...
androidjavajsonapicomtest driven developmentopen sourceandroid developmentgraspdesigntabletsmobilesfeaturesinterfacesinstrumentsconventionsPair ProgrammingBehaviDriven DevelopmentDomainDriven DesignQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketioQualified lawyers with 1 to 3 years experience in any court or legal field, with command over written and spoken languages, analytical brains, capacity to learn quickly and grasp the intricacies and e...
legaldraftingarbitrationcivilfilinggraspexpresscommandanalyticalGoF PatternsFEKOSOLID PrinciplesAntenna MeasurementsCST Microwave StudioVISSIMNetwork AnalyzerMean StackDomainDriven DesignAspectOriented ProgrammingSocketio
Candidate Detail:
Experience 4.5+8 years Location-Noida Mandatory skills: Java Angular version 2 and above- Must HTML & CSS- Must Database Good to have LiveLink Python & D...
javascriptcssjqueryhtmlmysqljmstddjavarestpythondjangodatabaseangularjsangularPair ProgrammingBehaviorDriven DevelopmentDomainDriven Design
Eligibility: Any graduate/Post graduate
Skills: Knowledge in other ecommerce platforms like Magento,woo - commerce, BigCommerce, Must have worked on 5 ...
A successful candidate should have worked in a startup- like environment with high levels of Ownership. Job Responsibilities Have excellent coding skills should be able to convert the design into co...
design patternscssgitdesignownershipjavascriptangularArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlHeuristic EvaluationRefactingDomainDriven DesignMobile DeHiring for- Mumbai-OPX2 script / Planisware-C2H Position Skills : OPX2 script,Planisware, TDD, BDD,Javascripts Exp : (5-9)Years,...
Pair ProgrammingRSpecSoftware CraftsmanshipExtreme ProgrammingATDDNUnitRefactoringCertified Professional Resume WriterExecutive BiosBehaviorDriven DevelopmentDomainDriven DesignContent Writter - 04 Looking Yii Developer having Strong knowledge of PHP web frameworks Yii with Understanding of MVC design patterns object oriented PHP programming. Apply Now Location: Lucknow,...
design patternsphpyiidesignArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlCodeIgniterLaravelSymfonyYiiCakePHPRefactingDomainDriven DesignZend FramewPhpMyAdJob Description 4- 6 years progressive experience in design and development of consumer internet product space Strong technical background with good understanding of product development life cycle Gre...
life cycledesign patternsconsumer internetproduct developmentcssexceldesignjqueryangularjsbootstrapjavascriptArchitectural PatternsSTLOOADSOLID PrinciplesMultithreadingRefactingDomainDriven DesignNote : 3rd Party Payroll Number of post : 1 Gender : Male / Female Industry : IT Skills : Mandatory Skills : NodeJS Any Rest API framework (added advantage in case of Express JS or SailsJS) Re...
design patternsapiguiresttapemochadesigndockerexpresssourcingblueprintarchitectureArchitectural PatternsRefactoringSTLOOADSOLID PrinciplesMultithreadingNUnitDomainDriven DesignProficient development skills in PHP, Understanding of MVC design patterns, JavaScript, HTML5, and CSS3, MySQL Experience: 2+ Years Package: DOE Number of Vacancies: 1 Location: Innovation Hub, Ko...
javascriptcssjqueryhtmlmysqldesign patternsphphtml5designinnovationcss3Architectural PatternsSTLOOADSOLID PrinciplesMultithreadingNUnitInversion of ControlRefactingDomainDriven Design
Must have 3+ years of hands-on experience in PHP Candidates must have 3+ years experience in Laravel, Yii2, PHP Frameworks. Knowledge of CMS like WordPress, Magento is an added advantage. Candidat...
test driven developmentfront endwordpress cmsweb developmentsoftware solutionsphpcmstestsmagentolaravelsoftwarewordpressmaintenanceperformanceintegrationarchitectureimplementationPair ProgrammingBehaviorDriven DevelopmentDomainDriven De
Eligibility: Any graduate/Post graduate
Skills: Knowledge in other ecommerce platforms like Magento,woo - commerce, BigCommerce, Must have worked on 5 ...
© 2019 Hireejobs All Rights Reserved