Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Urgent opening for .NET DEVLOPER for Coding Brains Company, Expirience should be minimum 1 yr mendatory and maximum 3 to 4 yr. we are looking for some like framework like .NET, sql, MVC. SALARY PAC...
sqlmvc.netDesignation -: C# Devloper Location -: Delhi Job Discription -: C# Full Stack Developer role We are looking for a team player with knowledge of all phases of the software development lifecycle inc...
technical skillscode reviewentity frameworkdependency injectioncritical thinkingchange controlbusmicrosoft azuretechnical standardssql server.netasp.net mvcdatabase designsoftware development life cyclesoftware developmentsqlcssangularDesignation -: C# Devloper Location -: Delhi Job Discription -: C# Full Stack Developer role We are looking for a team player with knowledge of all phases of the software development lifecycle inc...
technical skillscode reviewentity frameworkdependency injectioncritical thinkingchange controlbusmicrosoft azuretechnical standardssql server.netasp.net mvcdatabase designsoftware development life cyclesoftware developmentsqlcssangularLooking for a developer having strong Hadoop Big Data skills with a proven record of delivery on major software projects. Will be working in the design, development and enhancement to a new applicatio...
pythonhdfshadoopproject administrationhivedata transformationairflowbig dataapidesignequal employment opportunityclouderadriveslakesolversoftwaresparkdata governanceempowerWe are looking to hire a WordPress developer to work at our corporate office (Websetters Mohali) This will be a full- time position for someone who is looking to work as a web developer and want to ex...
front endcustom workweb technologiesphpcssexcelmysqlemailskypethemespluginswordpressWeb StandardsW3CMicroformatsAccessibilityBackEnd Web DevelopmentCrossbrowser CompatibilityFrontend DesignFrontend CodingPHP Web Developers
Increment after every 6 months
We are looking for highly talented, motivated and driven individuals w...
content management systemscore phpopen sourceteam handlingwordpress cmsshopping cartweb applicationsproject managementcontent managementmanagement systemsclient communicationproject administrationphpcsscmshtmlajaxcartmysqldrupalare looking suitable candidates for Drupal Developer , details are mentioned below:- Required Skills and Experience on: Should have working experience on Drupal Sites 7.x or 8.x Experience in de...
gitphpjava scriptjquerydrupalcakephpsymfonylaravelcodeigniterjsonConsultant/Senior Backend developer Inviting applications for the role of Senior Backend Devloper where we are looking for a candidate with a solid focus on Infrastructure and Applications to help ou...
mysqljavascriptcssapihtmlbusiness case developmentfront endlife cyclepostingclient focushybrid cloudbusiness casewindows servercloud securityLead Consultant/Senior Backend developer Inviting applications for the role of Senior Backend Devloper where we are looking for a candidate with a solid focus on Infrastructure and Applications to he...
mysqljavascriptcssapihtmlbusiness case developmentfront endlife cyclepostingclient focushybrid cloudbusiness casewindows servercloud securityWe are looking for BDE (Buiness Devloper exicutive) Candidate .working in life insurence company & Age Limit : - 25 to 35 years , Merried women are intrested this job can also apply,...
life insuranceinsuranceCasualty InsuranceGeneral InsuranceLegal LiabilityLiabilityCommercial InsuranceReinsuranceUmbrella Insuranceking with BrokersPropertyCasualty InsuranceXamarin Forms Dev- C#, Xamarin, Xamarin Forms, Xamarin Android, Should know Xamarin form Should know Xamarin Android and iOS development to a good extent...
ios developmentiosformsandroidxamarinCore DataCocoa TouchCocoaInterface BuilderCore AnimationCore GraphicsXcodeCocos2dUIKitiPodiLifeiTunesiPad DevelopmentApple CertifiedElectronic FormsCandidate has showcased handson expertise working on React and Node(Full stack devloper) on 3 to 4 projects and led them from the front. Must hold expertise in AWS (Primary) Good to have knowledge on ...
safetycommissioningsiteinspectiontroubleshootingweb servicesagile scrumdbsawsgitjirarestmysqlagileredisscrumnosqloracledevopskanbanTitle Full Stack Python Devloper(AngularJS, NodeJS, BootStrap, HTML,DJnago).-Minimum 3 years ofrelevant Experience, Salary-As per Industry,Job Location Bangalore. Apply Now Categories IT Jobs , Web De...
front endintelligent networksproject administrationormhtmlhtml5pythondesignsalarydjangoare looking suitable candidates for Drupal Developer , details are mentioned below:- Required Skills and Experience on: Should have working experience on Drupal Sites 7.x or 8.x Experience in de...
gitphpjava scriptjquerydrupalcakephpsymfonylaravelcodeigniterjsonCreated with Snap Sr. Software Developer B.E / B.Tech (IT) 4 - 8 Years Pune View Career Opportunities | Senior Software Devloper | Excellon Software First Name * Last Name * Phone Number * Current...
sql serverjavascriptjqueryhtmlsqlsoftware solutionssoftware developmenterpctclinqsnapwindowssoftwareopeningsk processescareer opptunitiescnetaspnetadonetJob Description Experience in programming Embedded C++ applications with strong background in C++ inheritance, templates and pointers. Strong in OS concepts like efficient multi-threading and resour...
embedded cembedded cversion controldefect trackingdevelopment toolsfunction generatorembedded developmentconfiguration managementspiarmrtci2cudsooaduartcanoedesignAndriod Devloper Job code: Android Position: Software Engineer Vacancy: 2 Job type: Full Time Department: Software Department Gender preferences: MALE Minimum qualifications: Bachelors Experien...
javasqljavascriptsql serverjqueryandroidsoftwareBinary Runtime Environment for WirelessJ2MEBadaNDKSymbianWindows MobileiOSAndroid SDKBlackberry OSBusiness ServicesFuture TrendsPeripheralsManaged HRole : Object Oriented Concepts & Design skills Programming Fundamentals (Java / JEE / Spring) and Debugging Skills Experience with Presentation Layer technology stack Angular 2 and above, HTML5, C...
spring mvcspring dataprofiling toolsintegration testingjsfejbjpagitjavaj2eejirasdlcresthtml5agilesonardesignspringtestingjenkinsWe are looking for a Android Devloper with strong knowledge in Android SDK and Working with remote data via REST and JSON Required Skills 1. Professional development experience with a strong underst...
androidjavajsonapicomandroid sdkmobile developmentdatabase managementsdkrestmysqldesignmobilesqlitedatabasemanagementcommunicationNDKDDMSAndroid StudioDomain Trading Domain (optional) Location NOIDA Sec 16 Communication Skills Should be excellent Job Location- Noida Yrs of Exp-1.5+Yrs Backend Developer- Good Experience in No...
communication skillswritten communicationawsgitseclinuxmongodbtradingcommunicationOral CommunicationWritten ExpressionWritten WordWritten CorrespondencenodejsreactjsVerbal DeescalationDear Candidate, Greetings! Profile:Software Developer(GoLang) Key Responsibilities:
Qualifications: Bachelors degree in computer science, Engineering or a related field. 4+ years of proven work experience in .Net software development. Strong know...
sql serverdesignanalysisapientity frameworksoftware developmentmongodb.netpharmaapi developmenthl7clinicalsoftwareoopsqlangularoraclesoftware devloperPHP Web Developers
Increment after every 6 months
We are looking for highly talented, motivated and driven individuals w...
content management systemscore phpopen sourceteam handlingwordpress cmsshopping cartweb applicationsproject managementcontent managementmanagement systemsclient communicationproject administrationphpcsscmshtmlajaxcartmysqldrupalWebsite Design/ Development Company in Surat, India Job Description Web Designer Develop and execute compelling creative designs to engage customers and prospects Produce new website designs, and ba...
htmlcssjqueryjavascriptphotoshopfront endweb designingcreative artsgraphic designproblem solvingpresentation skillsconcept developmentphpflashemaildesignbannersJOB DESCRIPTON:- 60 % in Android development and 40% in C#, .Net (5 to 8 Years) - C#, .Net, Android application development Exp : 5 to 8 Years...
android applicationdata structuresembedded linuxandroid application developmentandroidembedded cscalabilityembedded softwareandroid developmentmultithreading.netsoftware designdistributed systemssystem architecturedesign patternsreal-timProficient in Computer skills, Microsoft office.,High proficiency in spoken and written English essential. Diploma/Degree with relevant marketing experience.,Must be passionate about Market Research,K...
javacommunicationmarketingindependencesoftwareadvertising researchcommunication skillsverbal communicationprimary researchmarket researchcomputer skillsPHP Web Developers
Increment after every 6 months
We are looking for highly talented, motivated and driven individuals w...
content management systemscore phpopen sourceteam handlingwordpress cmsshopping cartweb applicationsproject managementcontent managementmanagement systemsclient communicationproject administrationphpcsscmshtmlajaxcartmysqldrupal
Required Skills for Dot Net & Angular Devloper Extensive work experience in .NET framework and Anguar JS. Development related Code, debug, and test software , networked, or web services/app...
front endunit testingweb applicationweb applicationstechnical supportstored proceduresmanagement systemsintegration testingcommunication skillsjavascript librariesnet frameworkRevonextsoft is giving opportunity to Junior Software Devloper with an agile team to develop, test, and maintain web and desktop-based business applications built on Microsoft technologies. The Employ...
Application Development Engineer Software Engineer Software Developer Required Male Dedicated Candidate 3yr Experience in marketing Field with graduate Above in Real Estate Sector
...
Greetings from Right Fit Resources!!!
we are hiring Dot net Devloper in Bhubaneswar.
A net developer is responsible for producing code using . net languages such as C# and VB. Ne...
Created with Snap Sr. Software Developer B.E / B.Tech (IT) 4 - 8 Years Pune View Career Opportunities | Senior Software Devloper | Excellon Software First Name * Last Name * Phone Number * Current...
sql serverjavascriptjqueryhtmlsqlsoftware solutionssoftware developmenterpctclinqsnapwindowssoftwareopeningsk processescareer opptunitiescnetaspnetadonetDear Candidate, Hiring for, 1)AndriodDeveloper(Full Time) Experience: Min 2- 6Yrs CTC: Min 25-35k Per Month Male Candidates Working Days: 6 days working (Alternate Saturday Off) Edu...
android developmentandroid application developmentandroid developerandroid application developerExperience: 4-8 years Work Location: Pune/Bangalore
Website Design/ Development Company in Surat, India Job Description Web Designer Develop and execute compelling creative designs to engage customers and prospects Produce new website designs, and ba...
htmlcssjqueryjavascriptphotoshopfront endweb designingcreative artsgraphic designproblem solvingpresentation skillsconcept developmentphpflashemaildesignbannersWe at Spykesoft Technologies Immediately looking for- Software devloper (.NET) Skills Required For Software Engineer 1. Proficient in ASP, .NET. 2. Should knowledge in MVC. 3. Expertise in current co...
photoshopjavascriptvenuehtmlcommercialcomputer hardwarejqueryhardwaresql serveranalyticaloopstimingsoftwareaspjavaphpcodeigniter.nethondametroWe are looking for a Android Devloper with strong knowledge in Android SDK and Working with remote data via REST and JSON Required Skills 1. Professional development experience with a strong underst...
androidjavajsonapicomandroid sdkmobile developmentdatabase managementsdkrestmysqldesignmobilesqlitedatabasemanagementcommunicationNDKDDMSAndroid Studio1. Development and delivering mid to large scale Enterprise Applications on Microsoft Platform. 2. Recommending and participating in activities related to the design, development and maintenance of th...
delivering projects on timesql serverunit testingmusic makingweb applicationsystem architectureaustralian equitiessoftware developmenttechnical leadershipAndriod Devloper Job code: Android Position: Software Engineer Vacancy: 2 Job type: Full Time Department: Software Department Gender preferences: MALE Minimum qualifications: Bachelors Experien...
javasqljavascriptsql serverjqueryandroidsoftwareBinary Runtime Environment for WirelessJ2MEBadaNDKSymbianWindows MobileiOSAndroid SDKBlackberry OSBusiness ServicesFuture TrendsPeripheralsManaged HVB.NET Developer/ c# Devloper [ Posted Date : 08 Jun 2019 ] No. Of Vacancy : 1 Experience : 1+ Years Candidate should be graduate or above (B.Tech IT / B.E. IT / BCA / MCA / M.Sc. IT). Candid...
asp netxmlvb netweb serviceslinqajaxdesign patternsdevelopernet framewnet developerJava Devloper Cloudbourne Junior Devloper- Java/ J2EE Stack careers@cloudbourne. co Junior Devloper- Java/ J2EE Stack We are seeking a Java Developer, a key resource to be part of our team with great...
javamysqljsphibernatespringobjectunit testingregression testingenterprise softwareinterpersonal skillsproject administrationautomated testingdb2awsj2eeiaassaaspaascloudazureiented programming10 years experience in Java. Worked on Advanced Java framework like Spring and Hibernate, Multi- Threading. Having experience writing web- services in Java. Efficient with Eclipse. Worked on build...
build toolsadvanced javaphpjavahtmlmysqlmavendesignspringwritingmongodbhibernatejavascriptintegrationEclipsedatabase queriesdatabasereptingIOS Developer (Day Shift / Night shift) 1 - 3 yrs(B tech / BCA / MCA background) Job Description No Position 02 ios devloper - Webastral Webastral No Position 02 Requirement: - Experience developin...
swiftiosxcodeobjective cjsonios sdkcocoa touchweb servicesphpxmlsdkoopscocoasounddesignmobileiphonesqliteparsingbuilders Job Description of full stack devloper
Understanding the specifications create finest, safest, effective and user-friendly marketplace for B2B stock liquidation and stakeholders
We are looking for a Android Devloper with strong knowledge in Android SDK and Working with remote data via REST and JSON Required Skills 1. Professional development experience with a strong underst...
androidjava jsonapi comandroid sdk mobile developmentdatabase management sdkrestJava senior devloper Cloudbourne Senior Devloper- Java/ J2EE Stack careers@cloudbourne. co Java senior devloper Senior Devloper- Java/ J2EE Stack We are seeking a Senior Java Developer, a key technol...
javajquery sql serversql environmentbig data enterprise softwareagile methodologies intJava Devloper Cloudbourne Junior Devloper- Java/ J2EE Stack careers@cloudbourne. co Junior Devloper- Java/ J2EE Stack We are seeking a Java Developer, a key resource to be part of our team with great...
java mysql jsp hibernate spring object unittesting regressiontesting enterprisesoftware interpersonalskills projectadministration automatedtesting db2 aws j2ee iaas saas paas cloud azure entedprogrammingRequired Skills: Strong experience of complex e-commerce implementations on Demandware platform with Java Backend Experience working in DW service framework Proficient in Demandware foundational co...
agiledevelopment java agile scrum design scripts business analysis AgileProjectManagement ProjectManagement TestDrivenDevelopment ContinuousIntegration Scrum iteGenesisEssential: Bachelor, or Masters, Degree in Information Technology Min 3 years of relevant industry experience( 3- 8 yrs of exp) Key Purpose of the Role: The role will include implementing NM produ...
mediation running adhesives marketing java networking documentation it oracle plastics government consulting ewproductdevelopment processengineering informationtechnology designf injectionmolding productdevelopment© 2019 Hireejobs All Rights Reserved