Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
#Health Agency Sales, Looking for Health Insurance Experience Candidates. Responsible for generation of Health Business. Recruitment of Agency force. Presentable with Good communication Skills. ...
sales marketing businessdevelopment retail target agencysales territorysales healthinsurance agency insurance territory recruitment communication HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife elffundedTo execute the business plans for the assigned accounts (Banks & Alliances) of company within territory. Create the excitement for Health Insurance within the partner organization through various enga...
sales marketing businessdevelopment retail insurance healthinsurance business engagement accounts HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform DisabilityInsurance Cpk Selffundedthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications At least 5+ years to 8 Years of hands on experience in Testing a...
strongcommunicationskills grouplife buildtools webservices groupmedical lifeinsurance mobiledevices testautomation sprintplanning webapplications agilemethodology personalaccident java accidenDear Candidate, We have an urgent requirement of Executive-Corporate Relation for Processing of Health Claims at our Jaipur location. JD Good Communication Skills TPA Exposure candidates will be g...
healthclaims groupmedical healthinsurance tpa mail claims medical insurance presentation communication Gratuity Joinings Mediclaim GeneralistProfile ESIC KRA ExitFormalities ProvidentFund LeaveManagement ullfinalsettlementGenerated Reference from an existing clients. Deal in Life Insurance and Health Insurance . To gave proper knowledge of Financial Goal Try to Close the sale . To Provide proper Services to the ban...
lifeinsurance healthinsurance ctc insurance incentives HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife DisabilityInsurance Gratuity ERTMS elffunded HealthCareRef JoiningFCustomer Service Voice Operations | Trenz Management Services Posted 1 month ago Responding to customer queries related to health insurance claims, policy etc. through calls. ,...
customerservice healthinsurance insuranceclaims managementservices claims insurance management operations HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife elffunded HealthCareRe#Jobs Telamon, #Health Agency Sales, Looking for Health Insurance Experience Candidates. Responsible for generation of Health Business. Recruitment of Agency force. Presentable with Good commun...
sales marketing businessdevelopment retail target agencysales healthinsurance agency insurance recruitment communication HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform DisabilityInsurance elDear candidates, we have good job opening for you in one of the leading broking comapany of India. Location : AHmedabad Designation :Franchisee Relationship Manager JOb Description : Would be res...
captiveinsurance insurancebrokerage broking finance self-funded graduaterealestateinstitute healthsavingsaccounts procurement indemnity accreditedbuyer tat groupmedical certifiedresidential accreditedstagingprofessional accounts employmentpAutomation Tester with C# Selenium Experience Experience in C# Development API Automation SQL Query Health insurance Domain knowledge,...
automation selenium java testng functionaltesting healthinsurance sql api insurance HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife elffunded HealthCareRef DisabilityInsuWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedProKarma is currently hiring for AEM Technical Leads that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Hands - on ...
java environment sql j2ee ajax html aem ehavioraltraining accidentinsurance personalaccident sqlserver grouplife lifeinsurance componentdevelopment customerrelations groupmedical adobemarketingcloudProKarma is currently hiring for Sitecore Technical Architect that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Ov...
java net delivery sqlserver grouplife unittesting groupmedical codecoverage lifeinsurance webapplication designpatterns codingstandards personalaccident applicationdesign sessionmanagement ramewthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications At least 5 - 7 years of hands on experience in Testing and Test ...
strongcommunicationskills grouplife buildtools webservices groupmedical lifeinsurance testautomation sprintplanning webapplications agilemethodology personalaccident accidentinsurance mob javaSeasoned QA Lead with Agile/ SCRUM experience in multiple implementations. Strong expertise in QA processes, Requirements Traceability processes, Test Planning and Execution, Automation Test experie...
testcases automation java functional customerrelations grouplife testplanning groupmedical lifeinsurance testautomation personalaccident accidentinsurance requirementstraceability it utomationframew ksthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Experience should have 4 years to 6 years of hands on experience...
strongcommunicationskills grouplife buildtools webservices groupmedical lifeinsurance mobiledevices testautomation sprintplanning agilemethodology personalaccident accidentinsurance java commuProKarma is currently hiring for .Net/ UI - Senior Developers that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Ex...
java jquery sqlserver sql environment grouplife unittesting groupmedical lifeinsurance versioncontrol sprintplanning equipmentsupply solidprinciples persona spnetmvc netframew entityframewthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications At least 5+ years to 8 Years of hands on experience in Testing a...
strongcommunicationskills grouplife buildtools webservices groupmedical lifeinsurance mobiledevices testautomation sprintplanning webapplications agilemethodology personalaccident java accidenthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Technical Skills: Should have 6 years to 8 years of experience. Shou...
java environment sqlserver sql customerrelations versioncontroltools grouplife unittesting groupmedical lifeinsurance designpatterns versioncontrol sprintplanning entityframework equipmentsupply solidprinciples personalaccident accidentinProKarma is currently hiring for Automation QA Technical Architect that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications...
java agile automation customerrelations databaseadministration rootcauseanalysis testdata rootcause grouplife teststrategy qaautomation groupmedical lifeinsurance datamanagement testautomation odiProKarma is currently hiring for J2EE/ MicroServices Technical Manager that would like to join our team. The selected individual should have worked as a part of a global development team. Qualificat...
testdrivendevelopment grouplife springboot webservices zerodefects cloudfoundry groupmedical lifeinsurance riskmanagement qualityanalysis personalaccident accidentinsurance avaframew ks behavithat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Should have 6 years to 8 years of experience. Should have exte...
java environment sqlserver sql customerrelations versioncontroltools grouplife unittesting groupmedical lifeinsurance designpatterns versioncontrol sprintplanning equipmentsupply spnetmvc solidpWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedWe are Hiring for Senior HR Executive for a Leading E - Commerce Company for Statutory compliance Work location - Only Chennai - Outstation candidate telephonic interview will be con...
medicalinsurance behavioraltraining hr mis hindi salary medical payroll joining insurance statutory HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife HealthCareReform elffundedUrgent Hiring for the Aditya Birla Health Insurance Company for the Agency Manager Profile. qualification- Graduation designation- Agency Manager Profile. ctc- 2.5 to 3.5lpa + Incentive & Onroll J...
sales lifeinsurance marketing businessdevelopment insurance healthinsurance behavioraltraining salary agency business HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance alesmarketing SelffundedUrgent Hiring for the Aditya Birla Health Insurance Company for the Agency Manager Profile. qualification- Graduation designation- Agency Manager Profile. ctc- 2.5 to 3.5lpa + Incentive & Onroll J...
sales lifeinsurance marketing businessdevelopment insurance healthinsurance agencymanagement behavioraltraining salary agency management HealthSavingsAccounts HMO PPO GroupMedical alesmarketing Selffunded
ProKarma is currently hiring for J2EE/ MicroServices Technical Manager that would like to join our team. The selected individual should have worked as a part of a global development team. Qualificat...
testdrivendevelopment grouplife springboot webservices zerodefects cloudfoundry groupmedical lifeinsurance riskmanagement qualityanalysis personalaccident accidentinsurance avaframew ks behaviThe Health Insurance Agencies, the Clients of Maxvision Placement Services, are looking for the candidates eligible for sales job on higher positions. The candidates should be experienced in the menti...
healthinsurance placementservices sales insurance placement HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife DisabilityInsurance PlacementAssistance elffunded HealthCareRef
Customer Service Voice Operations | Trenz Management Services Posted 1 month ago Responding to customer queries related to health insurance claims, policy etc. through calls. ,...
customerservice healthinsurance insuranceclaims managementservices claims insurance management operations HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife elffunded HealthCareReGenerated Reference from an existing clients. Deal in Life Insurance and Health Insurance . To gave proper knowledge of Financial Goal Try to Close the sale . To Provide proper Services to the ban...
lifeinsurance healthinsurance ctc insurance incentives HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife DisabilityInsurance Gratuity ERTMS elffunded HealthCareRef JoiningFProKarma is currently hiring for J2EE/ MicroServices Technical Architect that would like to join our team. The selected individual should have worked as a part of a global development team. Qualific...
javanetdeliverysqlservertestdrivendevelopmentgrouplifespringbootzerodefectscloudfoundrygroupmedicallifeinsurancequalityanalysispersonalaccidentaccidentinsuranceramewjavaframewProKarma is currently hiring for J2EE/ MicroServices/ Full Stack Technical Manager that would like to join our team. The selected individual should have worked as a part of a global development team. ...
javaagileprojectmanagementdeliverycustomerrelationstestdrivendevelopmentgrouplifespringbootwebserviceszerodefectscloudfoundrygroupmedicallifeinsuranceriskmanagementavaframewqualSeasoned QA Lead with Agile/ SCRUM experience in multiple implementations. Strong expertise in QA processes, Requirements Traceability processes, Test Planning and Execution, Automation Test experie...
testcasesautomationjavafunctionalcustomerrelationsgrouplifetestplanninggroupmedicallifeinsurancetestautomationpersonalaccidentaccidentinsurancerequirementstraceabilityutomationframewProKarma is currently hiring for .Net Full Stack Senior Developers that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications...
javajquerysqlserversqlenvironmentgrouplifeunittestinggroupmedicallifeinsuranceversioncontrolsprintplanningequipmentsupplysolidprinciplespersonaspnetmvcnetframewentityframewProKarma is currently hiring for Principal Architect MicroSoft Technology Stack that would like to join our team. The selected individual should have worked as a part of a global development team. Q...
architecturaldesignarchitecturesitecustomerrelationstendermssqlgrouplifecodereviewclientsideunittestinggroupmedicallifeinsurancemodelingtoolsdesignpatternsspnetmvcnetframewthat would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Technical Skills: Should have 6 years to 8 years of experience. Sh...
javaenvironmentsqlserversqlcustomerrelationsversioncontroltoolsgrouplifeunittestinggroupmedicallifeinsurancedesignpatternsversioncontrolsprintplanningequipmentsupplyspnetmvcsolidpProKarma is currently hiring for .Net Full Stack Developers that would like to join our team. The selected individual should have worked as a part of a global development team. Qualifications Tech...
grouplifeunittestinggroupmedicallifeinsuranceversioncontrolsprintplanningequipmentsupplysolidprinciplespersonalaccidentaccidentinsurancespnetmvcnetframewentityframewbehavi" Designation: Group Health Underwriter Experience: Minimum 4 years Job location: Hyderabad Responsibilities: Provide pricing to sales for business sourced from market for group health ba...
healthinsurance risk sales resume business insurance demography underwriting HealthSavingsAccounts HMO PPO GroupMedical WholeLifeInsurance UniversalLife tfolio Selffunded HealthCareRef DisabilityInsurancHi, We are presently hiring for Banca Insurance sales Profiles at various levels for Top Most Life and Health Insurance Companies. Our clients are looking for the candidates with sales Experience in ...
mailperformanceprofilesbusinessinsurancemarketingself-fundedbankingsalesrecruitmentppoealthinsurancecustomerrelationsgroupmedicalhealthsavingsaccountsbehavioraltrainingHi, We are presently hiring for Banca Insurance sales Profiles at various levels for Top Most Life and Health Insurance Companies. Our clients are looking for the candidates with sales Experience in ...
mailperformanceprofilesbusinessinsurancemarketingself-fundedbankingsalesrecruitmentppoealthinsurancecustomerrelationsgroupmedicalhealthsavingsaccountsbehavioraltrainingHi, We are presently hiring for Banca Insurance sales Profiles at various levels for Top Most Life and Health Insurance Companies. Our clients are looking for the candidates with sales Experience in ...
mailperformanceprofilesbusinessinsurancemarketingself-fundedbankingsalesrecruitmentppoealthinsurancecustomerrelationsgroupmedicalhealthsavingsaccountsbehavioraltrainingRequired Sales and Agency Managers for renowned health Insurance company for Thane, Mumbai Location. Graduate candidates with 1 to 5 years of experience from Insurance/banking/NBFC or Finance can app...
marketingagencysalesinsuranceifeinsurancebusinessdevelopmentwholelifeinsurancedirectsalesgroupmedicalhealthinsurancechannelmanagementuniversallife5+Yrs experience into Business Analysis with Health Insurance Domain. Immediate joinees required. Location: Hyderabad,...
customerrelationsdocumentationrequirementsfunctionalbusinessrequirementshealthinsurancebusinessanalysisbusinessanalysisinsuranceHealthSavingsAccountsHMOPPOGroupMedicalWholeLifeInsuranceelffundedDear Candidates We have Urgent Opening for Noida Locations Job Requirement : Must have excellent communication skills . Should be comfortable for rotational shifts (For male candidate ) Day shift...
self-fundedmedicalremunerationppogratuityresumehmoinsurancebillingsalesbenefitscommunicationommunicationskillshealthsavingsaccountsemployeebenefitscustomerservicecustomerrelationswholelifeinsurancegroupmedicalmedicalinsuranceOpenings with Leading BANK for the post of Bancassurance Manager MUMBAI Interested please call MAHEK 022 40697707 or drop your CV at quotientconsultancy@gmail.com Desired profile : Bancassurance...
salesbancassurancelifeinsuranceinsurancebankinghealthinsurancemaxctcmailHealthSavingsAccountsHMOPPOGroupMedicalWholeLifeInsuranceUniversalLifeelffundedHealthCareRefDisabilityInsuranRoles and responsibilities Meeting the tie up hospitals and making business. Coordinating with doctors and closing the health Insurance business. Travelling to customer and closing the deal. M...
salesmarketinginsurancecustomerrelationsbankinghealthinsurancepharmahospitalsHealthSavingsAccountsHMOPPOGroupMedicalWholeLifeInsuranceUniversalLifeelffundedHealthCareRefDisabilityInsuranc© 2019 Hireejobs All Rights Reserved