Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Responsibilities: Examiner have to conduct examination in the following domain: Taking charge of shift and handing over shift to - Auto loom Weaving Machine fitter) come at least 15 - 20minutes ear...
yarnndustrialdesigntextileindustrialmaintenancehealthsafetytextiletechnologytextiledesigncottonCandidate should have knowledge of the following: Prepare and maintain work area-preparing the equipment, products and work area ahead of service delivery to ensure the efficiently and effectiveness ...
beapedicurealonsskincarehaircutpersonalcarebeautybeautycarehygienebeauticianskintreatmentmedicurethreadingmachinesbeautytherapistwaxinghealthsafetyskinstructuregroomingbeautytherapylegfootDentist responsibilities and duties -
Responsibilities: Examiner have to conduct the examination in the following domain: Carry out pre warping activities Cleaning the warping machine Calculation for raw material requirement Creeling...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiledesigncottonResponsibilities: Examiner have to conduct examination in the following domain: Creeling the speed frame bobbins and taking the rove through drafting zone and piecing the ends. Cleaning the draftin...
yarnextileindustrialdesigntextiledesigningtextiledesignindustrialhealthyarndyeinghealthsafetytextiletechnologyoccupationalhealthcottonResponsibilities: Examiner have to conduct examination in the following domain: Running bare card before feeding cotton Feeding lap Collecting the web and condensing to feed to the calender roller...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiletechnologyindustrialplantengineeringtextiledesigncottonDear Applicant, As the manager of the spa, he/she would play a very important role in the day to day operations of the spa and health club department. Should strive to maintain and motivate the entire...
managementfocusyogaspaireexercisepreventionhealthsafetycustomerservicecustomerViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:HotelSpaManagerworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-05-31baseSalary:{@type:Responsibilities: Examiner have to conduct the examination in the following domain: Carry out pre warping activities Cleaning the warping machine Calculation for raw material requirement Creeling...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiledesigncottonResponsibilities: Examiner have to conduct examination in the following domain: Creeling the speed frame bobbins and taking the rove through drafting zone and piecing the ends. Cleaning the draftin...
yarnextileindustrialdesigntextiledesigningtextiledesignindustrialhealthyarndyeinghealthsafetytextiletechnologyoccupationalhealthcottonResponsibilities: Examiner have to conduct examination in the following domain: Running bare card before feeding cotton Feeding lap Collecting the web and condensing to feed to the calender roller...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiletechnologyindustrialplantengineeringtextiledesigncottonDear Applicant, We are looking for an organized and hardworking janitor to join our company. Youll be responsible for keeping our building clean. In addition to keeping the inside of the building cle...
windowscleaningonitoringtrashbinshealthsafetyenvironmentalcontrolsystemsbulbsmaintenancemanagementViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:JanitorworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-06-23baseSalaDear Applicant, We are looking for an organized and hardworking janitor to join our company. Youll be responsible for keeping our building clean. In addition to keeping the inside of the building cle...
windowscleaningonitoringtrashbinshealthsafetyenvironmentalcontrolsystemsbulbsmaintenancemanagementViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:JanitorworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-06-23baseSalaCandidate should have knowledge of the following: Prepare and maintain work area-preparing the equipment, products and work area ahead of service delivery to ensure the efficiently and effectiveness ...
beapedicurealonsskincarehaircutpersonalcarebeautybeautycarehygienebeauticianskintreatmentmedicurethreadingmachinesbeautytherapistwaxinghealthsafetyskinstructuregroomingbeautytherapylegfootResponsibilities: Examiner have to conduct examination in the following domain: Taking charge of shift and handing over shift to - Auto loom Weaving Machine fitter) come at least 15 - 20minutes ear...
yarnndustrialdesigntextileindustrialmaintenancehealthsafetytextiletechnologytextiledesigncottonDear Applicant, As the manager of the spa, he/she would play a very important role in the day to day operations of the spa and health club department. Should strive to maintain and motivate the entire...
managementfocusyogaspaireexercisepreventionhealthsafetycustomerservicecustomerViewsimilarjobs{@context:http://schema.org@type:JobPostingtitle:HotelSpaManagerworkHours:hiringOrganization:CompanyHiddenvalidThrough:2019-05-31baseSalary:{@type:Responsibilities: Examiner have to conduct the examination in the following domain: Carry out pre warping activities Cleaning the warping machine Calculation for raw material requirement Creeling...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiledesigncottonResponsibilities: Examiner have to conduct examination in the following domain: Creeling the speed frame bobbins and taking the rove through drafting zone and piecing the ends. Cleaning the draftin...
yarnextileindustrialdesigntextiledesigningtextiledesignindustrialhealthyarndyeinghealthsafetytextiletechnologyoccupationalhealthcottonResponsibilities: Examiner have to conduct examination in the following domain: Running bare card before feeding cotton Feeding lap Collecting the web and condensing to feed to the calender roller...
productionyarnndustrialdesigntextiledesigningtextilehealthsafetytextiletechnologyindustrialplantengineeringtextiledesigncottonNurses plan and provide medical and nursing care to patients in hospital, at home or in other settings who are suffering from chronic or acute physical or mental ill health. Duties -
No IELTS REQUIRED 1.Maintain accurate, detailed reports and records. 2.Monitor, record and report symptoms and changes in patients conditions. 3.Record patients medical information and vital signs. 4...
healthgnmnursingnursingdocumentationhealthsafetyhealthcareservicesmidwiferyoperationtheatremedicalResponsibilities: Examiner have to conduct examination in the following domain: Taking charge of shift and handing over shift to - Auto loom Weaving Machine fitter) come at least 15 - 20minutes ear...
yarnindustrialdesigntextileindustrialmaintenancehealthsafetytextiletechnologytextiledesigncottonCandidate should have knowledge of the following: Prepare and maintain work area-preparing the equipment, products and work area ahead of service delivery to ensure the efficiently and effectiveness ...
beapedicuresalonsskincarehaircutpersonalcarebeautybeautycarehygienebeauticianskintreatmentmedicurethreadingmachinesbeautytherapistwaxinghealthsafetyskinstructuregroomingbeautytherapylegfootCandidate should have knowledge of the following: Prepare and maintain work area-preparing the equipment, products and work area ahead of service delivery to ensure the efficiently and effectiveness ...
beapedicuresalonsskincarehaircutpersonalcarebeautybeautycarehygienebeauticianskintreatmentmedicurethreadingmachinesbeautytherapistwaxinghealthsafetyskinstructuregroomingbeautytherapylegfootWe urgently required persons for Assessment work as per following criteria Qualification : B.Tech (Any Stream) Experience : 2 or more years Job Location : North India Salary : As per experience an...
documentationhealthsafetysocialresearchcommunicationskillssurveyreportintegrity© 2019 Hireejobs All Rights Reserved