Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Handling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literacy...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literac...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursOur Sales team is involved in sell the solution and individual packages to travel agents. The role involves coordinating with travel agents across India through tele- calling / chat- support and onlin...
sales marketing businessdevelopment target customerrelations holidaypackages marketingstrategy it tal training business strategy bookings ticketing operations incentives australasia accounts rep ting FamilyHolidayJob Description - Handling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile - Must be a graduate. Good and sound knowledge of costing and itinerary preparat...
tourpackages computerliteracy tours sound costing english literacy preparation itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways sc tedTours CulturalVacancy : 2 Working Experience : 0 Year - 2.5 Years The candidate will be responsible for sales of South East Asia / Europe packages. Designing itinerary , costing , booking hotels. Handling Custo...
seo sales osting business packaging holidaypackages customerhandling kingexperienceDesignation : Business Development / Sales Executive For Tour Packages / Travel Positively engaging with client and ensuring his final closure. Achieve monthly target Business development for various...
sales marketing businessdevelopment target customerrelations tourpackages his tours rentals business designation australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing sc tedTours FamilyHSr. Executive Sales and Operations ( International Holidays )
Job Responsibility - Sales generation through Existing customers base. Develop new customers & opportunities . Mandatory skill set to establish , Maintain & expand the customer base . Identifying...
sales amadeus customerservice selling air msoffice communicationskills gds hindi tourism english anguageskills excelpowerpoint holidaypackages effectivecommunication it set excel outlook punjabiDesignation : Business Development / Sales Executive For Tour Packages / Travel Positively engaging with client and ensuring his final closure. Achieve monthly target Business development for various...
sales marketing businessdevelopment target customerrelations tourpackages his tours rentals business designation australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing sc tedTours FamilyHHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literacy...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literac...
tourpackages computerliteracy tours sound costing english literacy itineraries TourDevelopment HollandAmerica HolidayPackages TourMarketing FamilyHolidays RomanticGetaways CulturalTours Pri sc tedToursJob Description Working Experience : 1 Year - 3 Years The candidate will be responsible for sales packages. Designing itinerary, costing, booking hotels. Handling Customers for international hol...
sales communication osting outbound tourpackages holidaypackages kingexperienceProfile- Visa Executive Communicating & Understanding Clients Holiday Packages requirements. Handle the clients of Domestic as well as International. Visa preparation of Dubai, Singapore, Malaysia,...
tourism salary documentation isaassistance visaprocessing holidaypackages customerservice visadocumentationOpportunity to work With Hiring of Process Associates for Domestic and International process. (Airlines Travel) It is to handle either Sales or Customer care project. This project handles End to en...
galileo gds sabre ustomer fareportel igt ticking service convergys worldspan experida travelprocess hotelbooking holidaypackages interglobetechnologies apollo tourpackages reservationsticketingOpportunity to work With Hiring of Process Associates for Domestic and International process. (Airlines Travel) It is to handle either Sales or Customer care project. This project handles End to en...
galileo gds sabre ustomer fareportel igt ticking service convergys worldspan experida travelprocess hotelbooking holidaypackages interglobetechnologies apollo tourpackages reservationsticketingSEO Executive The candidate will be responsible for sales of South East Asia / Europe packages. Designing itinerary, costing, booking hotels. Handling Customers for international holiday packages, f...
seo sales selling osting holidaypackages01 To 05 Years Freshers Candidate Can apply. Experience in travel Industry. Good Geographical Knowledge. Should have a Computer with Internet at home. Responsibility : Avid Traveler or having Sales /...
budgeting costing tourism sales ourpackages holidaypackages customerrelations customerserviceJOB DESCRIPTIONS FOR TRAVEL CONSULTANT Dealing with customer queries Providing advice about Holiday package Package Costing Calculations and Itinerary Preparation. Presenting, Convincing & Selling...
sales calculations costing consulting galileo chat amadeus australasia ticketing selling design ourpackages holidaypackages tourmarketing tourdevelopment escortedtours customerserviceJOB DESCRIPTIONS FOR TRAVEL CONSULTANT Dealing with customer queries Providing advice about Holiday package Package Costing Calculations and Itinerary Preparation. Presenting, Convincing & Selling...
sales calculations costing consulting galileo chat amadeus australasia ticketing selling design ourpackages holidaypackages tourmarketing tourdevelopment escortedtours customerserviceInternational Travel process (Voice) - Travel process executive salary upto 25k +Incentives Both sides cab +meals 5 days working (2 Rotational off) Process - International Travel process (voice) ...
ticketing travel communication international process amadeus nternationaltravel inboundtravelprocess travelprocess hotelbooking holidaypackages internationalprocess internationalticketing travelsalesexecutive travelsales travelvoiceprocessInternational Travel process (Voice) - Travel process executive salary upto 25k +Incentives Both sides cab +meals 5 days working (2 Rotational off) Process - International Travel process (voice) ...
ticketing travel communication international process amadeus nternationaltravel inboundtravelprocess travelprocess hotelbooking holidaypackages internationalprocess internationalticketing travelsalesexecutive travelsales travelvoiceprocessInternational Travel process (Voice) - Travel process executive salary upto 25k +Incentives Both sides cab +meals 5 days working (2 Rotational off) Process - International Travel process (voice) ...
ticketing travel communication international process amadeus nternationaltravel inboundtravelprocess travelprocess hotelbooking holidaypackages internationalprocess internationalticketing travelsalesexecutive travelsales travelvoiceprocessFresher with sales and marketing interest can also apply. Roles and responsibilities: To understand the market & have source to generate business leads. To do the cold calling and take an appoint...
carrental coldcalling holidaypackages clientsatisfaction businessdevelopment clientservice hr sales basic resume tourism business benefits marketing australasia Honeymoons TravelServices TravelInsurance pollVacancy : 2 Working Experience : 0 Year - 2.5 Years The candidate will be responsible for sales of South East Asia / Europe packages. Designing itinerary , costing , booking hotels. Handling Custo...
seo sales osting business packaging holidaypackages customerhandling kingexperienceContact Kiran 9899332159 9821910557 Urgent Requirement for Noida Sector 60 iEnergizer Process - Travel Club Total no of requirement 100. Monthly CTC - Rs 25000/- (In hand Rs. 24700/-) Excellent co...
insurance bpo billing cce sales nboundprocess customerservice customercare customerrelations callcentrevoice nonvoiceprocess travelconsulting holidaypackages dayshift travelcoordinationWe are hiring for the below mentioned position in a leading travel industry Designation: Homebased agents(Freelancer) Location: Mumbai -Candidates must have good communication skills -Must have de...
tourpackages customerservice behavioraltraining bpo kpo ites less tours design salary operations australasia communication TourDevelopment HollandAmerica HolidayPackages TourMarketing EscortedTours amilyHoWere hiring for below mentioned possition in a leading travel company ; Designation: Team leader location: Mumbai CTC: Up to 4.20 Lpa Candidate must have travel industry experience Must have team...
sales customerrelations sla quality coaching traveldesk travelsales countersales teamhandling holidaypackages behavioraltraining hotel tours design salary operations itineraries australasia TravelSystemsDesignation - Sales Executives / Sr. Executives (Travel - Domestic) What will be your role & responsibilities - Directly involved in selling Domestic / Outbound Holiday Packages Destination knowled...
ticketing amadeus galileo customerservice sales travelsales holidaypackages hotel salary tourism selling outbound operations consulting designation australasia TravelSystems DutyFree TravelAssistance udgetTraveExperience in sale of tour packages both domestic and international. Experience of Europe location Experience in tour package preparation Salary 2 Lac To 5 Lac 50 Thousand P.A. Industry Hotel / Tra...
sales customerservice retail inventorymanagement marketing tourpackages hotel tours salary english australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing EscortedTours FamilyHolidays omaDear Candidates, Greetings from Flywidus! Urgent hiring for freelancers / Sales agents Responsibilities: 1) Cold calling and arranging the meetings with the Travel agents.(Data will be provided fo...
travel b2b freelancing marketing sales onboarding ealclosure agentrecruitment holidaypackages b2bmarketing travelagents outsidesales coldcalling interpersonalskills freelancer tourpackages b2bsales freelanceDesignation : Business Development / Sales Executive For Tour Packages / Travel Positively engaging with client and ensuring his final closure. Achieve monthly target Business development for various...
sales marketing businessdevelopment target customerrelations tourpackages his tours rentals business designation australasia TourDevelopment HollandAmerica HolidayPackages TourMarketing sc tedTours FamilyHHoliday Consultant at POST A RESUME (1 Opening) Work Experience: 1.0 Year(s) To 4.0 Year(s) - Operations and sales of inbound/ outbound Holidays. Handle online inquiries & materialize through mail a...
consulting marketing resolutions australasia outbound sales operations costing selling ustomerrelations behavioraltraining customerservice holidaypackagesWhisk Travelkaart, is seeking a proactive, self-starting Business Development Manager with a knack for public speaking and an ability to build iron-clad business relationships. Experience in the trave...
target tourism marketing sales tours eisureindustry hollandamerica touroperators tourdevelopment tourmarketing escortedtours romanticgetaways businessdevelopment customerrelations familyholidays culturaltours holidaypackages tourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesales ravelagency bposales voiceprocess dayshift internationalticketing travelprocess fresherscalling rotationaloff graduates internationalbpo holidaypackages tourpackages bpofreshers excellentcommunicationskills freshers callcenterCandidate should be Graduate.
Candidate should be Graduate.
Handling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literac...
tourpackagescomputerliteracytourssoundcostingenglishliteracyitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaysCulturalToursPritedToursHandling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile Should have good and sound knowledge of costing and itinerary preparation. Also computer literacy...
tourpackagescomputerliteracytourssoundcostingenglishliteracyitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaysCulturalToursPritedToursUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesutboundsalesvoiceprocessundergraduatestravelagencyinternationalticketingholidaypackagesgraduatesfresherscallingtourpackagesdayshiftinternationalbpoexcellentcommunicationskillsbposalesrotationalshiftgoodcommunicationskillstravelproUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesutboundsalesvoiceprocessundergraduatestravelagencyinternationalticketingholidaypackagesgraduatesfresherscallingtourpackagesdayshiftinternationalbpoexcellentcommunicationskillsbposalesrotationalshiftgoodcommunicationskillstravelproJob Description - Handling of Inbound tour packages, making itineraries and costing for Inbound Tours. Desired Profile - Must be a graduate. Good and sound knowledge of costing and itinerary preparat...
tourpackagescomputerliteracytourssoundcostingenglishliteracypreparationitinerariesTourDevelopmentHollandAmericaHolidayPackagesTourMarketingFamilyHolidaysRomanticGetawaystedToursCulturalOpening for Ticketing, Reservation and Holiday package - 7977686826 Candidate must be ok with rotational shift. job location: mumbai Suitable for candidate from western line. IATA certified would ...
diplomaticketinggdsiatadssystemsholidaypackagesfreshertraveldesktravelprocessamadeusgdsUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessfreshersbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgoodcommunicationskillsoutboundsalesinternationalbpoundergraduatesrotationalshiftgraduatesbposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgraduatesoutboundsalesinternationalticketinginternationalbpoundergraduatesrotationalshifttravelagencybposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessfreshersbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgoodcommunicationskillsoutboundsalesinternationalbpoundergraduatesrotationalshiftgraduatesbposalestravelprocessfresherscallingtourpackagesUrgent opening with Company and Many more options available. Handle Incoming/outgoing call from the clients. Resolving customer issues over call EXCELLENT Communication Skills Shift Timing - Rotat...
telesalesoiceprocessbpofreshersholidaypackagesexcellentcommunicationskillsdayshiftgraduatesoutboundsalesinternationalticketinginternationalbpoundergraduatesrotationalshifttravelagencybposalestravelprocessfresherscallingtourpackagesHiring for Reputed MNC International voice Domain-Travel process Salary upto 29,800 Unlimited incentives Shifts-24*7(US) Undergraduates or graduates with minimum six months of experience(Mandato...
worldspanincentivesgdssalaryfaresenglishaustralasiaticketingopeningscalbonusmadeusgdsholidaypackagesairlinereservationsgdssystemsinternationalvoiceairlineeconomicstravelprocessairlineticketingtourpackages*Sales Executive - Travel Outbound Sales* Good communication Skill. Knowledge for international destination is a plus point. Relevant Travel and Tourism qualification. 1-3 yrs of exp. 15 k to 30 k 1...
costingreparinginvoicesinternationalbpooutboundtravelsalesholidaypackagestourpackagescustomerservice© 2019 Hireejobs All Rights Reserved