manual therapy jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

manual therapy Job Openings

Showing 3551 - 3600 of 6641 Jobs

Medical Coding Critical Care,Clinical Care Technology- Ct Priya

Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 29 Oct, 2024

hidden_mobile

Medical Coding For Nursing, BPT, Pharmacy Grad -Ct JayaPriya

Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

hidden_mobile

hidden_email

Medical coding -karthiga HR

Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

hidden_mobile

hidden_email

medical coding

life science industry

biomedical

biotechnology industry

Medical Coder - Biomedical, Biotech, Bio-Chem Grad- CT Priya

Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Hyderabad, Tiruchirappalli, Coim 29 Oct, 2024

Medical Coding Job

CT HR Gokulapriya-hidden_mobile(Whatsapp )

Position: Medical Coder

zoologymedical codingbptpharmacynursingbiochemistryphysiotherapymptbiotechnology

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Bangalore,Aruba, Cameroon, Congo, Other Arunachal Pradesh, Noida, Chennai, Hyderabad, Gurugram, Kolk 29 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Microbiologist
SPENTO PAPERS (INDIA) LLP 20.00 to 25.00 Years Pune,Iran, Benin, Congo, Itanagar, Morocco, Iraq, Bangalore, Philippines, Chennai, Noida, Hyderabad, 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
qualitygmpbioburdenproblemmonitoringassurancecommunicationmicrobiologyasepticattentiondetailsolvingtechniqueenvironmental

Electronic technician
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 17.00 to 25.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi, Other AndamanNicob 24 Oct, 2024

We are looking for an electronic technician to set up, maintain and repair electronic systems and devices. Youll test system performance, analyze and report on results. This role requires hands-...
preventive maintenancehand toolsplcanalogoscilloscopescomputer systemcircuit boards

QA Selenium Automation IRC227463
GlobalLogic 5.00 to 9.00 Years Nagpur,Other Maharashtra 24 Oct, 2024

Description: A leading US telecom provider is seeking a Manual QA to join its API Program & Developers Portal Creation. Requirements: Must have 5 Years of Experience. Test planning and Test De...
Manual QATest planningTest DesignDefect trackingSTLCSDLCPerformance testingSecurity testingAutomation testingMobile testingTest environment preparationExecution of Test casesQA ProcessesCloudWeb platformWritten communication skillsOral comm

Merchandiser
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 24 Oct, 2024

Conceptualization and Innovation:

Conceptualize and create innovative concepts, styles, designs, and products that align with current tren...
excelfashion technologysurface ornamentatione-commercetextile designingmanualprintinghome furnishingsupervisor

Tester with CRM and life insurance domain
HARJAI COMPUTERS PRIVATE LIMITED 1.00 to 4.00 Years Mumbai City 24 Oct, 2024

Requirement: Position: Tester, Manual Tester and Test Engineer

Notice Period Immediate to Serving ca...
crm testinglife insurance

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Mumbai City,Pune, Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Noida, Chennai, Hydera 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Merchandiser
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 24 Oct, 2024

Conceptualization and Innovation:

Conceptualize and create innovative concepts, styles, designs, and products that align with current tren...
excelfashion technologysurface ornamentatione-commercetextile designingmanualprintinghome furnishingsupervisor

Medical Coding Critical Care,Clinical Care Technology- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Chennai, Thoothukudi, Salem, Tirupati, Kanyakumari, Tiruchirappalli, Vellore, Kanchipuram, 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biomedicalbiologybiochemistrynursingpharmacyphysiotherapymedical codingbiotechnology

medical coder for B.E B.Tech Biomedical biotechnology Bioinformatics- CT Jp
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Madurai, Bangalore, Chennai, Salem, Thoothukudi, Tiruchirappalli, Vellore, Coim 24 Oct, 2024

Medical Coding Job CT HR JayaPriya-hidden_mobile(Whatsapp ) Position: Medical Coder medical codingbiochemistrypharmacybiomedicalmptbiotechnologyzoologynursingphysiotherapy

Medical Coding for Ophthalmic Nursing Assistant - Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Chennai, Thoothukudi, Salem, Tirupati, Tiruchirappalli, Kanyakumari, Vellore, Kanchipuram, 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
medical codingbiotechnologybiomedicalphysiotherapynursingbiochemistrybiologypharmacy

Medical Coding Medical Laboratory Technology -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Madurai, Bangalore, Chennai, Thoothukudi, Salem, Tiruchirappalli, Vellore, Coim 24 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder biochemistrymedical codingnursingzoologypharmacymptbptphysiotherapybiotechnology

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Hyderabad,Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Noida, Chennai, Gurugram, Kolk 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Hyderabad,Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Noida, Chennai, Gurugram, Kolk 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Medical Coding -wanted Physician assistant graduates - Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Chennai, Salem, Thoothukudi, Tirupati, Kanyakumari, Tiruchirappalli, Vellore, Kanchipuram, 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
medical codingbiochemistrynursingpharmacybiologybiotechnologybiomedicalphysiotherapy

Merchandiser
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 24 Oct, 2024

Conceptualization and Innovation:

Conceptualize and create innovative concepts, styles, designs, and products that align with current tren...
excelfashion technologysurface ornamentatione-commercetextile designingmanualprintinghome furnishingsupervisor

Merchandiser
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 24 Oct, 2024

Conceptualization and Innovation:

Conceptualize and create innovative concepts, styles, designs, and products that align with current tren...
excelfashion technologysurface ornamentatione-commercetextile designingmanualprintinghome furnishingsupervisor

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Chennai,Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Noida, Hyderabad, Gurugram, Kolk 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Medical Coder -Biomedical, Biotechnology, Biology Grad-Ct Jayapriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bptbiochemistryphysiotherapybioinformaticsbiotechnologymedical codingmicrobiologybamsbhms

medical coding Dialysis Technology Cardiac Technology,Nursing -Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
zoologybioinformaticsbiochemistrynursingbiotechnologybiomedicalphysiotherapymedical codingpharmacy

Medical Coding Optometry, Radiology, Anesthesia grad-Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bhmsbiochemistrybamsmicrobiologybioinformaticsbiotechnologybptphysiotherapymedical coding

Medical Coding -wanted Physician assistant graduates - Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Salem, Thoothukudi, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
medical codingbiochemistrynursingpharmacybiologybiotechnologybiomedicalphysiotherapy

Medical Coding Wanted Biomedical, BSc, Nutrition Grad- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Tiruchirappalli, Kanyakumari, Kanchipuram, Coimbatore 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biotechnologymedical codingphysiotherapypharmacynursingbiochemistrybiomedicalbiology

Medical Coding Wanted Physician Assistant, BSc Grad- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Salem, Thoothukudi, Kanyakumari, Tiruchirappalli, Kanchipuram, Coimbatore 24 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biochemistryphysiotherapynursingbiotechnologymedical codingbiomedicalpharmacybiology

Medical Coding Radiology, Anesthesia graduates freshers wanted-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
pharmacybiotechnologymedical codingbiomedicalzoologybiochemistrynursingbioinformaticsphysiotherapy

Medical Coding Life Sciences & Paramedical Grad Wanted-Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bptmedical codingbiotechnologymicrobiologybioinformaticsbamsbiochemistryphysiotherapybhms

medical coding for Radiology & Imaging Technology Grad -CT Karthika hr
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
nursinglife science industrybiochemistrymicrobiologymedical codingzoologybiotechnology industrypharma

Medical Coding For Biochemistry,Bioinformatics,Microbiology -CT Karthika hr
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 24 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
pharmabiomedicalmedical codingnursingbiotechnology industrylife science industryzoologybiochemistry

Merchandiser
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 24 Oct, 2024

Conceptualization and Innovation:

Conceptualize and create innovative concepts, styles, designs, and products that align with current tren...
excelfashion technologysurface ornamentatione-commercetextile designingmanualprintinghome furnishingsupervisor

Medical Coding Medical Laboratory Technology -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Tiruchirappalli, Hyderabad, Coim 24 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder biochemistrymedical codingnursingzoologypharmacymptbptphysiotherapybiotechnology

Application Security Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 6.00 to 9.00 Years Bangalore,Chennai, Pune, Mumbai City 24 Oct, 2024

Greetings from Capgemini! We are pleased to inform you that we are conducting video call interviews for VAPT. Experience required- 4 to 12 Years Job D...
vaptvulnerability managementpenetration testingvulnerability assessmentdast

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Bangalore,Aruba, Cameroon, Congo, Other Arunachal Pradesh, Noida, Chennai, Hyderabad, Gurugram, Kolk 24 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Noida,Delhi, Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Chennai, Hyderabad, Gurugra 22 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Application Security Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED 6.00 to 9.00 Years Mumbai City,Pune, Bangalore, Chennai 22 Oct, 2024

Greetings from Capgemini! We are pleased to inform you that we are conducting video call interviews for VAPT. Experience required- 4 to 12 Years Job D...
vaptvulnerability managementpenetration testingvulnerability assessmentdast

Microbiologist
SPENTO PAPERS (INDIA) LLP 10.00 to 20.00 Years Delhi,Noida, Aruba, Cameroon, Congo, Other Arunachal Pradesh, Bangalore, Chennai, Hyderabad, Gurugra 22 Oct, 2024

We are looking to hire a microbiologist with outstanding research and analytical skills. Microbiologists should be technical and scientific experts with excellent interpersonal and communication ...
bioburdenenvironmental monitoringaseptic techniquemicroorganismsmicrobiology labtest resultslab equipmenttest methodsgrowth promotion

Medical Coding Medical Laboratory Technology -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Tiruchirappalli, Hyderabad, Coim 22 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder biochemistrymedical codingnursingzoologypharmacymptbptphysiotherapybiotechnology

Medical Coding Freshers for clinical care Technology -CT Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Bangalore,Salem, Vellore, Thanjavur, Madurai, Chennai, Thoothukudi, Tiruchirappalli, Hyderabad, Coim 22 Oct, 2024

Medical Coding Job CT HR Gokulapriya-hidden_mobile(Whatsapp ) Position: Medical Coder pharmacymptzoologybiomedicalmedical codingnursingphysiotherapybptbiotechnology

Structural Design Engineer
YALAMANCHILI 3.00 to 7.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

Manufacturing Job Title: Structural Design Engineer Department: Manufacturing Location: Vijayawada. Summary: YALAMANCHILI Engineers, a sister concern of YALAMANCHILI International Pvt Ltd., ...
Structural EngineeringSteel StructuresRCCAutoCADVerbal CommunicationWritten CommunicationProject Management

US Inside Sales Executive
Clonetab Inc 2.00 to 6.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

Company Description Clonetab Inc. is a software company based in Vijayawada that specializes in cloning automation and virtualization of Oracle e-Business Suite, PeopleSoft, and databases such as...
Inside SalesLead GenerationCommunicationCustomer ServiceNegotiationTeamworkSales Techniques

Admin Assistant
System Protection 1.00 to 5.00 Years Vadodara,Other Gujarat 19 Oct, 2024

Managing office supplies stock and placing orders Maintaining inward/outward record Verify Bills and site expenses Make travel arrangements, hotel bookings, etc. Maintaining company guest hous...
record keepingtravel arrangementsguest house managementmanpower handlingmeeting schedulingoffice coordinationadministrative processesdata entryoffice supplies managementexpense verificationcourier handlingreception desk managementdocument scan

QA Manual Engineer
Odysseus Solutions 3.00 to 7.00 Years Vadodara,Other Gujarat 19 Oct, 2024

Experience: Minimum 3-5 years Description We are looking for experienced Manual Tester who want to share their knowledge and learn new skills in a fun, intense and challenging environment. Whil...
JMeterSeleniumSOAPUIXML TestingResponsive Testing

Life science freshers for medical coder in Chennai-CT Karthika hr
Alpha Medical Coding Solutions 0.00 to 4.00 Years Pondicherry,Karaikal, Coimbatore, Chennai, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Cu 19 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobileWhatsapp ur resume) hidden_email Main bra...
nursingbiotechnology industrybiomedicalmedical codingbiochemistrymicrobiologyzoologypharma

ANM Nurse, Pharmacy, GNM & Lab Tech Graduates wanted -Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Pondicherry,Karaikal, Coimbatore, Chennai, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Cu 19 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile WhatsApp ur resume) hidden_email Main br...
biomedicalbioinformaticszoologyphysiotherapybiotechnologybiochemistrynursingmedical codingpharmacy

Medical Coding for Microbiology, zoology,Botany Fresher wanted-Ct Jayapriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Pondicherry,Karaikal, Coimbatore, Chennai, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Cu 19 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bhmsbioinformaticsphysiotherapymicrobiologybiotechnologybiochemistrybptbamsmedical coding

Medical Coding Biotechnology,biomedical,bioinformatics grad wanted -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Pondicherry,Karaikal, Coimbatore, Chennai, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Cu 19 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bptmedical codingbiochemistrymicrobiologybioinformaticsbhmsbiotechnologyphysiotherapybams

PREV
NEXT

manual therapy Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers