mechanical analysis jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

mechanical analysis Job Openings

Showing 33101 - 33150 of 34410 Jobs

Sr. Manager - Medical Services

LUPIN 5.00 to 10.00 Years Mumbai City 22 Sep, 2023

Qualification

Revant Experience:

Key Responsibilities:

Market Requirements Documents

Product Requirements

Consumer Electronics

medical

SW Project Manager 2023

Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Coordinate internal resources and third parties/vendors for the flawless execution of projects
Ensure that all projects are delivered on-time, within scope and wi...
deliveryproject managementcustomer relationsreportingjavaproject plansrisk management

apply now Vehicle Computer- Functional Safety Engineer

Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Mandatory skills:

Very Good understanding of ISO 26262 safety dev process
Hand-on experience of working on Microprocessor domain
Good ...
safetyfirst aidinspectionsiterisk assessmentsoftware engineeringprogramming languagestechnical documentationautomotive locksmithingagile scrum

Senior System Engineer

Merck Ltd 4.00 to 9.00 Years Bangalore 22 Sep, 2023

Anaesthesiologist

Vaishnavi Services 13.00 to 23.00 Years Bangalore 22 Sep, 2023

administers anesthesia to patients, monitors their vital signs during surgery, manages any medical issues that may arise, and ensures a smooth and safe recovery post-s...
manipulation under anesthesiaspinal decompressionanesthesiasoft tissue surgerydiversified techniquegonstead techniquewebster techniqueregional anesthesiaanesthesiology

Research & Development Scientist
QUISCON BIOTECH 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Key Responsibilities may include: Development of new designs, materials and device structures Application and development of material and process analysis and monitoring metrology Identificat...
research analysissite monitoringclinical researchproductionclinical monitoringelectronic data captureresearch administrationoperations

Req. now Senior Manager(L5) - Project Execution Press & BIW
Tata Motors Ltd 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Position Summary with Job Responsibilities Brief Role Description (one line description including travel if any) : Responsible for Equipment Engineering, System Integration, Inst...
financesalesltdmisaccountancyregulatory auditssystem integrationmanufacturing processsapplcplmbiw

KEY ACCOUNT MANAGER BANGLORE
VP ASSOCIATES Hiring For Maini Precision Products 5.00 to 10.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra KEY ACCOUNT MANAGER CTC: 15-18L We are seeking a highly motivated and experienced Key Account Manager with ...
key account managementkey accounts

Key account manager Bangalore
VP ASSOCIATES Hiring For Maini Precision Products 5.00 to 10.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra KEY ACCOUNT MANAGER CTC: 15-18L We are seeking a highly motivated and experienced Key Account Manager with ...
key accountsbusiness development

KEY ACCOUNT MANAGER
VP ASSOCIATES Hiring For Maini Precision Products 3.00 to 7.00 Years Bangalore 22 Sep, 2023

POSITION 1:Maini Precision Products Aerospace Division, Bommasandra KEY ACCOUNT MANAGER CTC: 15-18L We are seeking a highly motivated and experienced Key Account Manager with ...
key accountsbusiness development

Team Assemblers
Krishna Consultancy Hiring For Schneider Electric 10.00 to 20.00 Years Bangalore 22 Sep, 2023

Assemblers are a vital part of the manufacturing process and can be found in almost any field. Their job titles may vary according to the industry, but some commonly used titles for assemblers ar...
organizationdexterityphysical fitnessresource conservationdetail orientation

Property consultant Bangalore
TRIDENT INFOSOL PVT LTD 1.00 to 5.00 Years Bangalore 22 Sep, 2023

Position : Property Consultant Department : Real Estate Qualification : SSLC, PUC, Graduate Experience : 1 Years of Experience Timings : 9:30AM - 6:30PM (Sunday Off) Salary : 15,000 - 22,000...
property mattersproperty managementproperty acquisition

Property Consultant Bangalore
TRIDENT INFOSOL PVT LTD 1.00 to 5.00 Years Bangalore 22 Sep, 2023

Position : Property Consultant Department : Real Estate Qualification : SSLC, PUC, Graduate Experience : 1 Years of Experience Timings : 9:30AM - 6:30PM (Sunday Off) Salary : 15,000 - 22,000...
property mattersproperty managementproperty acquisition

Mechanical Engineer
Quess Corp (Magna Infotech) 4.00 to 7.00 Years Bangalore 22 Sep, 2023

Role: Mechanical Engineer Work Location: Bangalore/ Pune Experience: 4 to 7 years Np- 15days to Immediate Education Qualification: - DME / ME in Mechanical Engineering - Candidate must have...
vavecatia3d modeling2d drafting

Workday Technical Consultant
LTIMindtree Limited 5.00 to 8.00 Years Bangalore 22 Sep, 2023

Must have hands-on experience in Advanced Compensation and Talent Management modules

Assist with maintenance and configuration of existing Workday Core HCM application
workdaytechnicalcore hcm

Backend Executive / Data Entry
Fondstaff Private Limited 0.00 to 4.00 Years Bangalore 22 Sep, 2023

Job description Good in Advance Excel, Vlook up, Hlook up, Pivat Table Maintaining Mis of Data Collation ,Compilation Analysis Data and provide data for sales forecast. Required Cand...
back officedata entry work from homedata analysisdata entrydata entry typingmismis operationsback office operationswork from home typing

Urgent hiring for Mechanical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Bangalore 22 Sep, 2023

Job Description Mechanical Engineer Educational Qualification: BE / B.Tech in Mechanical Job Types : Freshers, Experienced Skill : AutoCAD Salary : Rs.25,000/- to 50,000/- Mechanical Engin...
design engineeringmanufacturingproduction planning controlproduction engineering

Hire Mechanical Engineer In Bangalore
JS Placement Services 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Designing and detailed engineering of Electrical and control systems aspect of ESS solutions. Sizing and Battery capacity finalization as per the requirement of various global tenders. Design ...
mechanical engineeringess

Mechanical Engineer In Bangalore
JS Placement Services 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Designing and detailed engineering of Electrical and control systems aspect of ESS solutions. Sizing and Battery capacity finalization as per the requirement of various global tenders. Design ...
mechanical engineeringelectrical panel design

Mechanical Engineer in Bangalore
Acme Placement Services 0.00 to 3.00 Years Bangalore 22 Sep, 2023

Mechanical Engineer Experience :3 Months To 1 Year Salary Budget :UpTo 2.50 LPA Designing and detailed engineering of Electrical and control systems aspect of ESS solutions. ...
spocsimulation tools

MECHANICAL ENGINEER BANGALORE
Alpine Manpower Services 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Designing and detailed engineering of Electrical and control systems aspect of ESS solutions. Sizing and Battery capacity finalization as per the requirement of various global tenders. Design ...
engineeringcable sizingcontrol systemsbusbar sizingelectrical panels

Urgent Hiring for Diploma Mechanical Engineer
Genius Consultants Limited Hiring For 3M India Fresher Bangalore 22 Sep, 2023

Freshers with Diploma Mechanical Engineering Degree. Role: Mechanical Engineer Diploma fresher Required Job type: Fresher Salary: 12k -16K(Take home) Mechanical Engineer are Responsible for ...
cadcommunication skillsoptimizationtime managementdata analysisnew product developmentmathtechnical knowledgeteam work

Customer Value Management Bangalore
ARCHISHTECH SOLUTIONS (OPC) PRIVATE LIMITED 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Create and manage CVM campaigns

Perform customer behaviour analysis and create, execute and monitor marketing campaigns for retention, churn and cross sell

Regularly ...
banking productsinsurance salesemibanking processbankingcommunication skillsstrong analytical skillstelecalling

Accounts payable in Bangalore
GETTJOBS Recruitment Firm Hiring For Accounts payable 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Hi Greetings from Gettjobs Openings foraccounts payable JD for Payable- CAT 1. Category Invoice processing for all segments - Ensuring Compliance TDS/GST /MSME/LTDS etc and ...
audit managementratio analysisreconciliationaccounts payablegstauditcataccountstds working

Sponsorship Sales Media Industry Bangalore
Morpheus Human Consulting Pvt Ltd 3.00 to 8.00 Years Bangalore 22 Sep, 2023

Job Title: Sponsorship Sales Media Industry Bangalore The key responsibility of the role entails conceptualising and launching conference IPs in identified industry...
relationship managementbusiness developmentsales

Bus. Intelligence Engineer, ISCAP - Var
Amazon 2.00 to 4.00 Years Bangalore 22 Sep, 2023

Amazon Web Services (AWS) provides a highly reliable, scalable, and low-cost cloud platform that powers thousands of businesses in over 190 countries. AWS Infrastructure Supply Chain & Procurement...
amazon web serviceshandle multiple projectsexploratory data analysisdata centersql queriestime seriessupply chainweb servicesrapid growthdata analysisdata modelingmodel buildingbusiness acumencommercial modelsinterpreting databusiness analy

Technical Lead Associate
Cognizant 2.00 to 0.00 Years Bangalore 22 Sep, 2023

Technical Lead Qualification: Bachelors in science , engineering or equivalent Responsibility: Requirement Understanding and Analys...
test datatest management tooltest cases

Urgent looking for Business Systems Analyst - SOX Compliance
Cisco Systems, Inc 3.00 to 7.00 Years Bangalore 22 Sep, 2023

What Youll Do You will be part of the Finance IT organization s SOX Control Execution Team that helps ensure Cisco has a strong internal control environment and is SOX Compliant. You will be wo...
it general controlsservice delivery managementoffice 365

Branch Credit Manager
AV Global Advisory Services 2.00 to 6.00 Years Vishakhapatnam 14 Sep, 2023

Urgent Vacancy with Leading NBFC Role - Branch Credit Manager Location - Delhi, Jaipur, Kota, Udaipur, Bhopal, Indore, Jabalpur, UP, Salem, Trichy, Hyderabad, Vizag Job Description

...
creditcredit analyst

Process Engineer
AVHAD ENTERPRISES 5.00 to 10.00 Years Vishakhapatnam 14 Sep, 2023

We are looking to hire a skilled process engineer to oversee the design and implementation of our company processes. As a process engineer, you will be responsible for developing and implementing...
designproject engineeringprocessoilfront end engineering designconstructionengineering change controlengineering consultancyengineering change managementgasengineering servicesmechanical engineeringengineering

Graduate Mechanical Engineer / Production /Quality Engineer
AVHAD ENTERPRISES 5.00 to 10.00 Years Vijayawada 14 Sep, 2023

We are looking for a skilled mechanical engineer to join our team. You will be responsible for working on all stages of our production cycles, from research and design to manufacturing, installat...
mechanical maintenancemechanicalgraduateproduction planning controlqualityproduct developmentengineering change managementproductionmechanical electrical plumbing

Electrician - Vadodara
Foursis Technical Solution 2.00 to 3.00 Years Vadodara 14 Sep, 2023

Job functions area : Design / Drafting (Electrical / Mechanical / Civil) Location : Vadodara Experience : 2 - 3 years Skills : designdraftingmechanicalmaintenanceDesign FirmsPattern CuttingDesignCADPattern MakingCreative Pattern Cutting

Require for District Entreprenureship Lead
Foursis Technical Solution 2.00 to 5.00 Years Vadodara 14 Sep, 2023

Job functions area : Sales / Business Development Location : Vadodara Experience : 2 - 5 years Skills : DISTRIBUTOR, BU...
lead generationbusiness analysisbusiness developmentsalesbusinessanalysisdistributionDemand Generation

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

Recruit for ITI Assembly Line
Foursis Technical Solution 1.00 to 2.00 Years Vadodara 14 Sep, 2023

Job functions area : Machine Operator / Mechanic / Electrician / Fitter Location : Vadodara Experience : 1 - 2 years Skills : mechanical engineeringmaintenance activitiesmechanicalmaintenanceengineeringAirframe

Require for Jr. Design Engineer Electrical - Vadodara
Foursis Technical Solution 2.00 to 3.00 Years Vadodara 14 Sep, 2023

Job functions area : Design / Drafting (Electrical / Mechanical / Civil) Location : Vadodara Experience : 2 - 3 years Skills : drawingautocaddraftingmodelingcadproduct managementelectrical maintenancedesignmanagementmechanical

looking for Practice Head- Vadodara
MNR Solutions Pvt Ltd 15.00 to 17.00 Years Vadodara 14 Sep, 2023

Job profile- Practice Head Experience 15+ years Location- Chennai / Bangalore/ Vadodara Qualification- Bachelors / Masters degree in engineering Job Location- Chennai/ Bangalore/ Vadodara Benef...
consultancy servicesmfg-pro

Aircraft Maintenance Engineer Recruitment
Kavya Staffing Solutions 0.00 to 4.00 Years Vadodara 14 Sep, 2023

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
technician activitiesaeronauticalaerospace designaircraft

Sales Development Manager A
The H R Friend 1.00 to 6.00 Years Vadodara 14 Sep, 2023

Sales Development Manager (SDM) Department:Agency Channel Company:(For- Indias Leading Life Insurance Company) Role and Responsibili...
field workfield salessalesfmcg salesbanking salesinsuranceagency channelbfsi salesfinance

Immediate Opening for Backend Executive / BPO Process
Fondstaff Private Limited 0.00 to 4.00 Years Pune 14 Sep, 2023

Responsibilities:

Input and update data from various sources into computer systems and databases

Verify accuracy and completeness of data entries
graduatebackendback officenon voice processbackend supportbpocommunication skills

Carpenter Foreman
AWINMO INDIA MARKETING PRIVATE LIMITED 8.00 to 13.00 Years Pune 14 Sep, 2023

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical

CONTRACT TO HIRE - PAM+ CyberArk consultant
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Pune 14 Sep, 2023

Skill: CyberArk+PAM Positions: 10 Location:Hyderabad/ Bangalore/ Noida/Chennai/Gurgaon/Pune/ Kolkata Experience 3- 7 Years Work Mode: Hybrid Need to work from office Professional Qualification...
cyberarkiampam

Industry Manager
KBESHA SOLUTION Hiring For Manufacturing company 10.00 to 15.00 Years Pune 14 Sep, 2023

Dear Candidate, Greetings fromKBESHA solution, We are hiring for our esteemed organization. Presently we needIndustry manager. Essential Job Function...
communicationcommercialproduct knowledgenegotiationexperience in direct sales of industrial producteffective

Senior Specialist, Scrum Master / Agile Delivery Lead
TALENTSTACK CONSULTING PRIVATE LIMITED 10.00 to 20.00 Years Pune 14 Sep, 2023

Designation / Position Senior Specialist, Scrum Master / Agile Delivery Lead

Job Description (Minimum 250 characters)* Job description The Scrum Maste...
scrum masteragile leadership

HIRING FOR Mechanical Design Engineer
Manpower Solution Fresher Pune 14 Sep, 2023

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Sales Development Manager (A1)
The H R Friend 1.00 to 6.00 Years Pune 14 Sep, 2023

Sales Development Manager (SDM) Department:Agency Channel Company:(For- Indias Leading Life Insurance Company) Role and Responsibili...
salesfield saleslife insurancefield workbfsi salesbanking salesfmcg salesinsurancefinance

BACK OFFICE EXECUTIVE PUNE
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Pune 14 Sep, 2023

Back Office Executive Responsibilities:

back officeinventory controlresearch analysismarket researchback office operations

GDC BI Developer
FERVOUR INFOSYSTEM PRIVATE LIMITED 8.00 to 11.00 Years Pune 14 Sep, 2023

define scope and methodology for dashboards and reports creation, participation in design phase for reports and dashboards Build the reporting data model and help the data engineering team with c...
bi toolstableau

Java Developer Pune
DC Consultants 3.00 to 6.00 Years Pune 14 Sep, 2023

Job description

Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system....
javascriptjqueryhibernate

Maintenance Worker
Garima Interprises Hiring For Garima Interprises 5.00 to 9.00 Years Pune 14 Sep, 2023

Maintenance workers, also known as repair workers, fix and maintain mechanical equipment, buildings, and machines. Tasks include plumbing work, painting, flooring repair and upkeep, electrical re...
problem solvingadaptabilityanalytical skillscommunication skills

PREV
NEXT

mechanical analysis Job Openings

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f... mechanicalskills.dexterity.mathproblem-solving.strength.physical

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin... mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Job description Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system.... javascriptjqueryhibernate

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical

Mechanical Design Engineer Job Description Template We are looking to hire a talented mechanical design engin...
mechanical maintenancemechanical electrical plumbingmechanical designmechanical testing

Job description

Perform Requirement analysis from the use case documents and work with SME to clarify and provide feedback as necessary. Design, Code, Test, and Document the system....
javascriptjqueryhibernate