Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Head - QA / QC 1 QA / QC Engineer 2 Site Engineer 1 Job Title Site Engineer Education Qualifications Bachelor Degree in Civil Engineering or equivalent Years of Experience Minimum 3 plus years in Cons...
sitesafetydrawinginspectionquality controlcivil engineeringconstruction planningcivillabourcontrolplanningeducationmaterialsfacilitiesmonitarchitectsengineeringmicrosoft wingDescription : Debtor & Creditor accounting, Monitoring & Handling Cash & bank Accounting & Bank Reconcilatoon Bill Passing for Material & Services Also Handling Petty Cash Internal Audit Experience ...
handling petty cashpetty cashbill passinginternal auditbank accountingfinancial justificationsapcashmonitLedgerCash ReceiptsPurchase LedgerPrepaymentTrial BalanceCreditVouchersDebtChecksing5. SAP Solution Manager Consultant Job Location: Pune No. of positions : 1 Role & Responsibilities : 5+ years of Solution Manager Technical Experience Candidate should have basic Understanding ...
sap basisroot causemusic makingsaprootbasicidealconsultingmonitcommunicationimplementationBasis AdministrationMaxDBSAP Security AdministrationSAP SolutionsSAP ArchitectureTREXsystem monitingingSOFTWARE ENGINEER SOFTWARE ENGINEER ORACLE DATABASE ADMINISTRATOR skills required: A good knowledge of physical database design. Ability to perform both Oracle and also operating system performance mo...
javasqljavascriptsql serverjquerycommunication skillssoundsoftwaresecuritydatabaserecoverymanagementmonitcommunicationacle databaseacle securityperfmance monitingaclevendingperfmanceAbility to handle more than three projects globally - Should have experience in planning project, proposals, client interaction, team building, team handling etc - Must get into coding / testing & c...
deliveryproject managementcustomer relationsjavateam handlingteam buildingproblem solvingquality assuranceclient interactioncommunication skillsdesigntestingplanningproposalsassurancemonitreptingingQuality Engineer Job Description We are looking for a quality engineer to monitor and improve the quality of our operational processes and outputs. The quality enginee...
u.s. pharmacopeiandequality controlequipmentcontrolmaterialsradiographic testingtroubleshootingtroubleshooting skillsinspectionamerican welding societycorrective actionscodesspecificationsquality standardsoperationsasntb31.3testingmonitManaging and overseeing the daily operations of the accounting department Monitoring and analyzing accounting data and produce financial reports or statements Establishing and enforcing proper acco...
tdsaccountssalesservice taxaccountingtally erpdaily operationsfinancial justificationerptallyoperationsmonitTax Deducted at SourceWingsFACTAccounting StandardsDirect TaxBRSingFinalization ofQualification / Experience : Any graduate with 7- 10 year experience in Retail Sector. Requirements : 1. Responsible for the smooth and effective functioning of the store. 2. Dealing with customer ...
salescustomer serviceretailmarketingfollowing upcustomer requirementsoperational requirementsmarket trendsfiguresplanningcoachingoperationsmonitschedulingappraisinginventy managementinventingmerchaExperience : 1 to 4 yrs in Clinical Research Associative. Responsible for conduct of Qualification visit, Site Initiation Visit, Monitoring Visit and Closeouts visit. Would be the first point of con...
site initiationclinical researchcrccrfctavisitethicsfillingtrainingresearchclinicalcloseoutspowerpointmonitinitiationpreparationcommunicationpresentationsstudy repregulatingAsst. Manager (SALES SUPPORT) Qualification: MBA/ PGDM (Marketing) Experience: 2- 4 Years Salary: Best in Industry Job Description Takes sales information and puts it into an easily readable format Ma...
salesmonitschedulingaccountsBusiness AlignmentCISASAS70GLBAIT RiskingrespondenceBusiness Infmation Services LibraryCertified Infmation Security ManagerCertified in RiskInfmation Systems ControlBest in Industry Job Description Takes sales information and puts it into an easily readable format Managing the correspondence between sales team their clients Providing data and reports to hel...
salesmarketingcustomer relationsbusiness developmentcold callingmonitschedulingaccountsBusiness AlignmentCISAingrespondenceBusiness Infmation Services LibraryCertified Infmation Security ManagerPatient Relations Executive Patient Relations Executive Age Department General Admin Job description: To visit patients to ensure that they are comfortable and satisfied with the services provid...
patient relationsvisitreferralsdischargeadmissionsPatient RegistrationPatient SchedulingPatient CommunicationsPatient FlowPatient AssessmentPatient SatisfactionService RecoveryinfPatient MonitingMonitoring of distant locations using various instruments for data collection. Routine material and water sample collection. The Person should be enthusiastic, a go- getter ready to travel routinely. ...
waterlessmonitdata collectionpeople skillstravelcollectiongo getteringenthusiasticPosition: Sr. .NET Programmer Required Work Experience: 3+ years, with at least 2 years in .NET development Education: B.E., B.Tech., M.C.A., MCS Profile: Strong knowledge of .NET Technologies(AS...
jquerysql servernetajaxjavascriptproblem solvingoopsmysqlrdbmsfinanceanalyticalProblem AnalysisPlanningProblem SensitivitySocial PerceptivenessOperation MonitingDecisionMakingTeam Problem SJob Title: Customer Service Executive Qualifications: Graduate / Post Graduation in any stream Key Responsibilities: Skills Required: Experience: 1 - 3 years Location: Kolkata Answer calls/ wsp pr...
customer servicesalesmisaccountsinsuranceequity marketproblem solvingcustomer complaintsturnexcellistenrecrecProblem AnalysisPlanningProblem SensitivitydingOperation MonitingDecisionMakingQuality Analyst Track Associate performance and its impact on the process/ project. Understand the process/ function goals and help the team to achieve them. Completing call monitoring and feedb...
qualitycustomer relationstest casescalibrationauditingsoft skillsdata analysisquality toolsfailure modesprocess qualitycustomer experiencedata interpretationconstructive feedbackbpocall monitingSeek customer feedback and develop action plans for improvement. Proactively communicate with customers and manage their expectations. Troubleshoot problems and resolve issues to maintain/ improve...
problem solvingcustomer satisfactionbpocourtesyanalyticalresolutionsdocumentationProblem AnalysisPlanningProblem SensitivitySocial Perceptivenesscustomer suppperfmanceOperation MonitingDecisionMakingTechnical Support executive (2) Level - 1, 2, 3 HostJinni is looking for experienced, talented, and motivated candidates, who are looking for a career in Linux Server/ System administration. Job Des...
customer servicetroubleshootingcustomer relationsphpwhmperlchateximbashcarelinuxmysqlapachewritingenglishcontrolscriptsmonittechnical suppnetwkingingConsultants lead a key portion of an engagement. They apply a broad range of creative problem-solving skills, combining technical and analytical excellence. They synthesize conclusions into recommenda...
problem solvinganalyticalsustainabilityProblem AnalysisPlanningProblem SensitivitySocial PerceptivenessTeam Problem SolvingNumeracyDocumentationVariance AnalysisOperation MonitingDecisionMakingSecondary ResBusiness Analysts take responsibility for a discrete part of the problem solving in each client engagement. They play an important role in the Research work and actively contribute to the teams final ...
customer relationsdocumentationrequirementsfunctionalbusiness requirementsproblem solvingexcelresearchbusinessdiscreteanalystspowerpointsustainabilityProblem AnalysisOperation MonitingDecisionMakingJob Description Responsibilities and Duties To dispense prescriptions accurately and promptly. To actively participate in the creation of the Pharmacy formulary. To process Billing of dispensed i...
recpatient safetyservice qualitysopstocksmedicalcontrolprofilesmonitRecRecMaintaining Professional Relationshipsd keepinginventy controlageinventingd Maintenanced StageOSHA Recd KeepinRoles & Responsibilities Driving the business with the clients and other stakeholders through telephonic calls, mailers, in-person, etc. To maintain and update a status monitoring mechanism on a re...
salesmisaccountstatbankinginhouse salesdigital marketingbusiness developmentcommunication skillsapplication developmentenglishmailersbusinessdevisingmarketingmechanismmonitnetwkingingperfmancepresRoles & Responsibilities Driving the business with the clients and other stakeholders through telephonic calls, mailers, in-person, etc. To maintain and update a status monitoring mechanism on a re...
salesmisaccountstatbankinginhouse salesdigital marketingbusiness developmentcommunication skillsapplication developmentenglishmailersbusinessdevisingmarketingmechanismmonitnetwkingingperfmancepresBachelor s Degree in IT (BSc IT/ CS, BCA, BE IT/ CS or equivalent) . Strong technical knowledge in Object Oriented Programming Concepts and data structures. Good logical and problem solving skills. Kn...
objectproblem solvingcommunication skillsprogramming conceptssqllinuxdatabasepostgrescommunicationProblem AnalysisPlanningProblem Sensitivityiented programmingOperation MonitingDecisionMakingSocialKey responsibilities include:Building robust & scalable software systems to support high trafficWell versed in agile development methodologiesUse best software development practices and processes incl...
javasqljavascriptsql serverjqueryunit testingagile developmentsoftware developmentangular jsphpagilepythondjangotestingreviewssoftwaremonitangularMoqsite monitingingJob Responsibilities: Become recognised as the focal point for the support of all first line voice support activities across a range of global systems listed below, and act as a lead facilitator in th...
salesdeliverycustomer relationsmarketingmanagementcisco call managerms officefocal pointservice deskcall managerteam managementmonitlogical securityvoice suppitil framewing toolsvendmanaJr. Network Engineer - Understanding of IP Network Infrastructure - Analytical and Problem Solving Ability - Communicate in English - Basic Computer and Microsoft Office,...
troubleshootingswitchesroutersciscoproblem solvingmicrosoft officebasicenglishanalyticalinfrastructureProblem AnalysisPlanningnetwkingnetwk infrastructureOperation MonitingDecisionMakingProblem Se(9 openings) Experience : 0- 3 Years Qualification : Attitude only. - Understanding of IP Network Infrastructure - Analytical and Problem Solving Ability - Communicate in English - Basic Computer a...
problem solvingmicrosoft officebasicenglishanalyticalinfrastructureProblem AnalysisPlanningProblem SensitivitySocial Perceptivenessnetwk infrastructureOperation MonitingDecisionMakingTeam Problem SolvSenior Resident / Attending Consultant - Anesthesia Position: Senior Resident / Attending Consultant - Anesthesia Job Qualification: MBBS , MD / DNB Anaesthesia Job Responsibilities: Pre Op check ...
anaesthesiamanagementsurgeryopdresearchdnbrecsedationequipmentdischargeconsultingmonitanesthesiasupervisionFileSurfLegalKeyEDRMSAccutracingFamily HistLocal HistNorthsoft Corporation - PHP Web Developers Jobs in Ludhiana We are in search of PHP Developers who are willing to work in friendly environment and having a great enthusiasm for coding and problem solv...
mysqljqueryjavascriptphpajaxproblem solvingproject administrationoopshtml5searchcss3Problem AnalysisPlanningProblem SensitivitySocial PerceptivenessTeam Problem SolvingOperation MonitingDecisionMaking
Qualification : MBA, Graduate
Experience : 0-2 Years
Job Requirements :
Job Code Position Qualification Experience Company Location - Project Manager (Highways) B.Tech Civil / Diploma Civil 10 years Ramky Infrastructure Limited Rajasthan / Imphal / Nagaland / MP / Srinag...
deliveryproject managementcustomer relationsjavalegal mattersshop drawingsboqciviltendercostingcontrolplanningmaterialsapprovalsmonitcompletionpreparationinfrastructurereptingderingPHP Jobs Chennai , PHP Fresher Jobs Chennai , PHP Jobs Chennai. Dot_ Net_ Jobs_ Chennai _ Dot_ Net_ Openings _ Chennai VB.NET / ASP.NET Jobs Chennai We have openings in VB.NET / A...
javajavascriptsqlcustomer relationshtmlproblem solvingphpbscnetemailvbnetresumetrainingopeningseducationcommunicationProblem AnalysisaspnetkeywOperation MonitingPosted on January 08, 2013 Category: Academic Experience: Mid Career (2+ years of experience) Description: Ope...
team handlingclient servicingprocess improvementoemspayrollplanningopeningsservicingliasoningmonitExecutive DevelopmentHiringLeadership DevelopmentCustomer RetentionreptingingMultiUnitPL ManagementJOB DESCRIPTION : De livering expert nursing care, monitoring and maintaining standards of care. Ongoing informal and formal assessment of patients in order to provide the most bene...
icusethimcarechecksnursingrecadditionequipmentmanagementmonitassessmentinterventionsCCUPICUBlood GasNeonatal Intensive Care UnitingIntraAtic Balloon PumpHemodynamic MonitingVentilatRoles and Responsibilities: Strong knowledge of SAP PI 7.0/ 7.3, PO 7.4 2. Should have experience in PI B2B Addon AS2 Adapter & mapping. Client upgraded their system fro...
sap pimonitbusiness systemsidentifying issuesmilestones professionalsap posapb2bftpsslrfcsldas2javaabapsoapidocing tools* Description & Job Responsibilities: We are looking for highly motivated and skilled DevOps engineer to help us design & develop tools for building & installing software for complex systems ...
safetycommissioningsiteinspectiontroubleshootingsoftware configuration managementtest casescomplex systemsmonitoring toolscontinuous integrationconfiguration managementcode analysis3. Ionic Developer Desired Candidate Profile: Experience: 1.0+ Years work experience with Ionic development Location: Freelance / Remote Work, Ahmedabad (Gujarat) India Role/ Responsibilities: Program...
objectproblem solvingsoftware servicesapplication programmingsounddesignsoftwaredebugginganalyticalmaintenanceProblem Analysisiented programmingk effectivelyOperation MonitingDecisionMakingPlanniHaving sound knowledge of Cordova development framework. Capable enough to understand the requirement. Additional Skills Requirement: Experience interacting with various APIs Flexibility to work ...
objectproblem solvingsounddesigndebugginganalyticalProblem AnalysisPlanningProblem SensitivitySocial Perceptivenessiented programmingk effectivelydovaOperation MonitingDecisionMakingTeam ProblemHaving sound knowledge of AngularJS. Capable enough to understand the requirement. Strong hand on design, development and problem solving skills as well good debugging and analytical skill. Ability...
objectproblem solvingsounddesigndebugginganalyticalProblem AnalysisPlanningProblem SensitivitySocial PerceptivenessTeam Problem Solvingiented programmingk effectivelyOperation MonitingDecisionMaking1. AngularJS Developer Desired Candidate Profile: Experience: 4.0+ Years work experience with AngularJS development Location: Freelance / Remote Work, Ahmedabad (Gujarat) India Role/ Responsibilities:...
objectproblem solvingsoftware servicesapplication programmingsounddesignsoftwareangularjsdebugginganalyticalmaintenanceProblem Analysisiented programmingk effectivelyOperation MonitingDecisionMakMumbai / Delhi / Pune / Nagpur / Kota Desired Profile Any one who has good knowledge of computer systems preferably having MCA / M.Tech / BCA / B.Tech / B.Sc. in Computer Science. Knowledge of C#, ...
phpsqlajaxsoftwarediagnosemonitaustralasiaBusiness AlignmentCISASAS70aspnetingBusiness Infmation Services LibraryCertified Infmation Security ManagerCertified in RiskInfmation Systems ControlServer Administrator Job location: Mumbai Experience: 2 years Number of Positions: 01 Candidate should have knowledge of Managing Networks, Server Installation and Maintenance, Host websites on server...
dhcpwindowsdnslinuxlotus notesweb hostingmail serverfile serverlinux serverprint serverremote controlsecurity systemspatch managementmonitantivirus serveractive directing toolstechnical suBasic understanding of Java projects - Java processes / Java Heap size. Knowledge of Java build tools such as ANT , Maven Good Knowledge of Web server and Application servers Basic Knowledge of XML Wo...
sqlcustomer relationsdatabase administrationlinuxaccountsversion control toolsweb serverbuild toolscustomer focusversion controlautomation toolsmonitrepting toolsactive directing toolsproductiAny one who has good knowledge of computer systems preferably having MCA / M.Tech / BCA / B.Tech / B.Sc. in Computer Science. Knowledge of C#, PHP, ASP.NET, SQL, AJAX etc. is an addon. Role Monitor...
phpsqlajaxsoftwarediagnosemonitaustralasiaBusiness AlignmentCISASAS70aspnetingBusiness Infmation Services LibraryCertified Infmation Security ManagerCertified in RiskInfmation Systems Control1- 3 Yrs Mar 6 System Admin : career Mar - 6 RHCE Redhat certified preferred.(Must) Knowledge about Redhat or CentOS operating system. DNS, NFS, Email Server, FTP. Disk Management. User Managemen...
email servershell scriptingdnsnfsmarrhcediskmysqlbasicemailredhatcentoshardwarescriptingmonitData GuardRMANAwkserver monitingnetwkingingDesign and Development experience in QNX Middleware framework Automotive domain exposure Very good problem solving and communication skills,...
problem solvingcommunication skillsqnxdesignautomotivemiddlewarecommunicationProblem AnalysisPlanningProblem SensitivitySocial PerceptivenessTeam Problem SolvingNumeracyOperation MonitingDecisionMakingSkill : Ansible tower Exp: 3-12Yrs Location: Bangalore, Chennai, Hyderabad, Mumbai and Kochi. Notice Period: 0 to 45Days( Prefer short joiners) If interested candidae ,...
ansibleCoreosLxcKubernetesSaltStackVagrantCephApache MesosMonitCobblerlooking for experienced candidate ICU nursing as nurse. Salary 1 Lac 25 Thousand To 3 Lac P.A. Industry Medical / Health Care / Hospitals Work Experience 2 - 8 Years Qualification Diploma, Other Bache...
icucaresalarymedicalnursinghospitalshealthcareCCUPICUBlood Gasstaff nurseIntraAtic Balloon PumpHemodynamic MonitingVentilatAccountant Above 5 years experience Accountant is responsible for managing Accountants handling Month end Close process for multiple payable and receivable ledgers and perform AP / AR Balance Sheet Ac...
balance sheetclose processaudit compliancefinancial analysisbalancebusinessanalysiscompliancemonitescalationaccountantsTrial BalanceLedgerestablishing priitiesreptingingperfmanceCash Flow S© 2019 Hireejobs All Rights Reserved