Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
DESCRIPTION:- Must have scored above 65% in their graduation, and XII class exams. Good programing skills, and must be logical and analytical in thinking. 2 years of experience...
sql servernetjqueryjavascripthtmlweb developmentdata structuressqlerdflexmysqldesigncontroldatabaseanalyticalstructuressilverlightfundamentalsaspnetalgithmsDESCRIPTION: - Must have scored above 65% in their graduation, and XII class exams. Good programing skills, and must be logical and analytical in thinking. 2 years of experience with web developme...
web developmentdata structuressqlxmlcsserdflexmysqldesignjqueryjavascriptsilverlightdocumentationaspnetcontroldatabaseanalyticalalgithmsstructuresfundamentals- Must have scored above 65% in their graduation, and XII class exams. Good programing skills, and must be logical and analytical in thinking. web development on ASP. NET (C# ) ...
sql servernetjqueryjavascripthtmldata structuressqlneterdflexmysqldesignsilverlightdocumentationcontroldatabaseanalyticalalgithmsstructuresfundamentalsDESCRIPTION:- Must have scored above 65% in their graduation, and XII class exams. Good programing skills, and must be logical and analytical in thinking. 2 years of experience with web developmen...
sql serverweb developmentdata structuressqlcsserdflexmysqldesignjqueryjavascriptsilverlightdocumentationaspnetcontroldatabaseanalyticalalgithmsstructuresfundamentals
Candidate must have at least a BE , BTech , MCA. DESCRIPTION: - Must have scored above 65% in their graduation , and XII class exams. Good programing skills , and must be logical and analytical in...
web developmentdata structuressqlcsserdhtmlflexmysqldesignjqueryjavascriptsilverlightdocumentationaspnetcontroldatabaseanalyticalalgithmsstructuresfundamentals
Urgent opening for Bancassurance in Leading Insurance company Location_ Ahmedabad Package Upto 4Lpa + Incentive Description Getting or generate leads from allotted Bank/Securities companies Its ...
salesmarketingtargetbusiness developmentinsurancenetsalarybancassurancecommunicationstrengtheningWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntity FrameworkNHibernateTeam FouInvimatic is looking for top- notch full stack Developers who has strong understanding of developing applications using .Net. We are looking for developer who always trying out new languages, framewor...
lessdatabasesapplicationsframewsql pl sqlactivitiestechnical suppautomateweb api03 Dot Net Developer Aerospace BE/BTech/MTech C#/Asp.net (Web) 2-9Yrs .NET Developer responsibilitiesinclude:
Job Title: Senior Associate Tester Location: Mumbai About RWS: RWS Holdings plc is the world s leading provider of technology-enabled language, content management and intellect...
qualityinsurancecustomer relationssubject matter expertssalesmarket accesstest automationtest suitesmisstock exchangevirtual machinescustomer valueSAP C4HANA -Technical Consultant Exp: 5-8yrs Location: Bangalore Mandatory / Preferred Skills:
Hi Urgent Job opening For Dot Net DEVELOPER Pune,Bangalore,Coimbatore,Chennai,Hyderabad Skill: Java springboot microservices Java Angular springboot Java Springboot REST webservices Java AWS FSDs...
sql servernetjqueryjavascripthtmlnetawsdotctcjavarestresumeangularWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntity FrameworkADONETHi Urgent Job opening For Dot Net DEVELOPER Pune,Bangalore,Coimbatore,Chennai,Hyderabad Skill: Java springboot microservices Java Angular springboot Java Springboot REST webservices Java AWS FSDs...
sql servernetjqueryjavascripthtmlnetawsdotctcjavarestresumeangularWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntity FrameworkADONETSkills:
BackEnd Developer Sitecore Developer 5+ years (mandatory) Dot Net (Mandatory) Site core headless /JSS optional Key Skills: BackEnd Developer Sitecore Developer 5+ years (mandatory) Dot Net (Manda...
netdotbackendsitecoreWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntity FrameworkNHibernateTeam Foundation ServerADONETSenior Software Engineer (SSE) position requires a motivated, enthusiastic, and proactive engineer with an excellent can-do attitude. As part of our software development team the SSL will be responsib...
sql serverjavasqlcustomer relationsjavascriptobject oriented designcode reviewcorporate taxmicrosoft wordproblem solving.Net developer ( Visual Studio, C# , SQL server) Position : .Net developer ( Visual Studio, C# , SQL server) Exp : 1-3 Year exp ( Fresher do not apply please) ,...
visual studiosqlnetLanguage Integrated QueryReSharperTeam Foundation ServerSilverlightWindows Presentation FoundationNUnitXAMLData StructuresEmbedded CWinFADONETRealTime Operating SystemsEmb
Educational Qualification - Minimum Graduation Mandatory male Candidates Preferred salary Offered - Net Take Home 9400/ - for Freshers/ 10000/ - for Experience per Month, Plus Attractive Incentives....
educational qualificationnetsalaryeducationWindows Communication FoundationLanguage Integrated QueryWindows Presentation FoundationSilverlightNHibernateTeam Foundation ServerWinFADONETEntity FramewBonJob Title : Sr. GIS Programmer Job ID : 4781944822 Posted on : 07/05/2021 Designation : GIS Programmer Experience : strong analytical skillsmicrosoft certified professionalwriting skillsimage processinganalytical skillsmicrosoft certifiedtechnology servicesengineering servicesinformation technologyapplication development
Programmer Analyst No of Position: 1 to 5 Yrs MCA/ MCM/ MCs/ BE - CS Skills: . Net, Silverlight, WPF, WCS, MVVM, web services, SQL Server, Oracle, Crystal Report,...
sqljavasql servercustomer relationsjavascriptweb servicesnetwpfwcsmvvmcrystalanalysissilverlightSQL Server Integration Servicescrystal repacleTransactSQLSQL Server Repting ServicesWindows CoYou must have atleast 1-2 years of experience in .NET Technologies specially MVC Framework. Please bring all your testimonials alongwith your ID proof at the time of Interview.,...
netprooftestimonialsWindows Communication FoundationLanguage Integrated QueryWindows Presentation FoundationSilverlightNHibernateTeam Foundation ServerPrinergyPitstopPrepsWinFADONETEntity FramewPreJob Code: ITD20120902: 0- 6 years . Net Designer Need to have good skills of . Net designing skills to design the website with customer requirements. Silverlight knowledge is neded. Experience Candida...
interpersonal skillsnetdesignsilverlightcommunicationIntrapersonal SkillsInterpersonal LeadershipInterpersonal RelationshipsReading PeopleExceptional mentcoachVerbal BehaviExceptionalganizationEasily.Net Designer Need to have good skills of .Net designing skills to design the website with customer requirements. Silverlight knowledge is neded. Experience Candidates are Preferred. At the same time ...
interpersonal skillsnetdesignsilverlightcommunicationIntrapersonal SkillsInterpersonal LeadershipInterpersonal RelationshipsReading PeopleExceptional mentcoachVerbal BehaviExceptionalganizationEasilMust-have skills (Mandatory):
Job Opening Details back to list Reference Code: SR462 Job Title: Dot Net with Angular / Dot Net Core Category: Position: Dot Net with Angular Exp: 1-3 Years Location: Chennai Contra...
windows presentation foundationlanguage integrated querynetwindows communication foundationnhibernatewinformssilverlightteam foundation serverdotcsa 2010fmcsrentity frameworkangularadonet.NET Developer Job Description Template. .NET Framework is a software framework developed by Microsoft. It is powerful, flexible, and can be adapted to a broad range of uses. Every .NET developer shou...
sql servernetjqueryjavascripthtmlnetdotsalaryvbnetsoftwareWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightnet frameworkADONETEntity
Core Skills: Hands on Expertise in application development using . NET technologies , ASP. NET 3. 5/ 4. 0/ 4. 5, C# Proficiency in SQL Server 2008/ 2012, T SQL Must have knowledge in JavaScript, J...
sql servernetjqueryjavascripthtmlweb servicessecure codingdatabase designcomputer scienceanalytical skillscommunication skillssoftware engineeringed proceduresperfmance tuningal communication
7. Job Code (LWD 671) Web Developers in .Net Candidates with minimum 2 years of experience.(Expertise in .Net framework 3.5 / 4.0 , C#.Net 3.5 / 4.0 , MVC , Silverlight 5.0 , WCF , WPF , XML , SQL Ser...
javascriptjquerywcfsqlcsshtmlxmlmysqlwpfnetsilverlighttransactsqlsql server integration servicesnet frameworksql serversql server reporting servicesproject administrationcnetsql server 2008Roles and Responsibilities understanding requirements, coding, designing architecture & scheduling on ASP.Net platform Conduct reviews, analysis, modification of programming systems according ...
sql serverjavascriptjqueryhtmlsqlreviewsbusinessanalysisschedulingarchitecturemodificationspecificationsLanguage Integrated QueryWindows Communication FoundationEntity FrameworkSilverlightaspnetADONETASPNET AJAXASPNET MVC.Net Developer - Paycor Location: Chennai, Tamil Nadu, IN Job Category: Technology C, .NET, NET Core, React JS, Azure, MSSQL, Entity Framework ,...
netnetazuretamilWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntity FrameworkNHibernateADONETStrong knowledge of Photoshop, Dreamweaver Must know HTML5 fetaures, jQuery and AJAX controls Very comfortable working in Visual Studio environment Bootstrap and LessCss, Responsive/ Adaptive web d...
sapbusiness objectdocumentationenvironmentvisual studioajaxhtml5designjquerybootstrapphotoshopLanguage Integrated QueryReSharperTeam Foundation ServerSilverlightproduction suppWinFWindows PresentaLooking for .Net Developer @ Ahmeadabad - TOPS Technologies Request a Call back Looking for .Net Developer @ Ahmeadabad June 21 , 2013 We are TOPS Technologies , one of the largest IT Training , Outso...
sql servernetjqueryjavascripthtmlms sqlit trainingunit testingproblem solvingaudio masteringtelerik controlssqlwpfiiswcfumlctcajaxOpportunity for for for our clients. Currently we are having great requirements for Sr.Net Developer. .NET , C#/VB.NET , ASP.NET , Silverlight , SQL Server2005 Provide technical and project guidance...
sql serverjavascriptjqueryhtmlsqlcode of conductquality checkproblem solvingproject administrationxmlctcnetajaxtopsemailsounddesigned proceduresaspnetExperience: 3 to 5 Years Should have work experience in .Net 3.5 or Latest versions. Excellent work experience with MVC 2.0 , 4.0 , SQL Server 2008 , WCF , Javascript and JQuery are must. Experience /...
flashprofilescommunicationjqueryjavascriptgalleryanalyticalsilverlightoopssqlwcfperformancenetsql serveperformance tuningtransactsqloptimization strategiesoral communicationsql serversql server 2008Huge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingSoftware Developer - Healthcare Position=1, Experience Range: Min: 3 years Max:5 years Location: Mumbai(2) Domain: Health care Min: 2 years Max:3 years Experience Range: Min: 3 years Max:5 years Q...
sql serverjavascriptjqueryhtmlsqlxmlhl7ajaxcarevbnetsoftwarehealthcaresilverlightSQL Server Reporting ServicesSQL Server Integration ServicesWindows Communication FoundationLanguage Integrated QueryaspnetTransactSQLExperience : 3 + years Qualification: MCA, BE, B-Tec, M.sc. Skill Set:
Huge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingHuge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingHuge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingHuge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingHuge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingHuge opening for ASP.Net Developer Experience: 4 to 8 years Notice period: immediate or 1 month Kindly share your CV on priya.hr.hi@gmail.com...
ado.netapplicationsentity frameworkcertified professional resume writerwcf serviceslanguage integrated querywindows communication foundationexecutive biosasp.net mvcwelfare-to-worksilverlightasp.netasp.net ajaxmvcinterview skills trainingRoles and Responsibilities 1.Languages: C#. 2. App Framework: .Net Framework/.Net Core. 3. Windows Framework: WinForms/WPF. 4. Relational Database: SQL Server/MySQL/Oracle. 5. Testing Fram...
sqlnettestingwindowsPLSQLXMLSQL Server Integration ServicesLoadSQL Server Reporting ServicesSQL TuningUnified Modeling LanguageWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntitRoles and Responsibilities 1.Languages: C#. 2. App Framework: .Net Framework/.Net Core. 3. Windows Framework: WinForms/WPF. 4. Relational Database: SQL Server/MySQL/Oracle. 5. Testing Fram...
sqlnettestingwindowsPLSQLXMLSQL Server Integration ServicesLoadSQL Server Reporting ServicesSQL TuningUnified Modeling LanguageWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntitRoles and Responsibilities 1.Languages: C#. 2. App Framework: .Net Framework/.Net Core. 3. Windows Framework: WinForms/WPF. 4. Relational Database: SQL Server/MySQL/Oracle. 5. Testing Fram...
sqlnettestingwindowsPLSQLXMLSQL Server Integration ServicesLoadSQL Server Reporting ServicesSQL TuningUnified Modeling LanguageWindows Communication FoundationLanguage Integrated QueryWinFormsWindows Presentation FoundationSilverlightEntit© 2019 Hireejobs All Rights Reserved