tool jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

tool Job Openings

Showing 2801 - 2850 of 3152 Jobs

Concierge Executive

RISEOM TOOL CRAFTS PRIVATE LIMITED 4.00 to 9.00 Years Noida 16 Oct, 2023

organizational management

interpersonal skills

customer service

flexibility training

Maintenance Supervisor

RISEOM TOOL CRAFTS PRIVATE LIMITED 4.00 to 9.00 Years Noida 16 Oct, 2023

ensuring that all building systems, equipment, and facilities in their charge operate at peak efficiency

Hiring for Mainframe System Programmer

Shreyas Technologies 0.00 to 5.00 Years Gurugram 16 Oct, 2023

Hiring for Mainframe System Programmer in Multiple locations.

project administration

Looker BI Developer (For Leading Big four)

Acura Solutions 2.00 to 4.00 Years Noida 16 Oct, 2023

Looker BI Developer (For Leading Big four)

Good experience in BI Tool- Looker and expertise in Lookml model development, extension framework, embe...
sqllooker bi

Embedded Design Engineer

Orbitouch Outsourcing Private Limited 2.00 to 7.00 Years Chennai 16 Oct, 2023

Urgent hiring forEmbedded Design Engineer || Chennai || WFO

embedded design

circuit designing

Safety Officer

AFFINITY STAFFING 0.00 to 2.00 Years Chennai 16 Oct, 2023

Job Details

Required Location: Bangalore, Chennai, Bellary, Hyderabad, Vishakhapatnam, Nellore
Fresher Experienced both Required
Salary: 16 fire safetysafety officer activitiessafetysafety trainingsafety engineeringsafety monitoringsafety auditsafety meetings

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Chennai 16 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Agile Coach
Infosys Limited 2.00 to 17.00 Years Bangalore 16 Oct, 2023

Enterprise Quality Solutions is the IT process and strategy consulting practice at Infosys. It provides consulting and implementation services in the areas of Enterprise Agile and DevOps transform...
agilecoachingscrumscrum masterjirastrategy consultingimplementation servicesgrcalmleanvstslesscloudrallydesigndevopskanban

Network Engineer Vijayawada
VAYAM INFO SOLUTIONS PRIVATE LIMITED 0.00 to 5.00 Years Vijayawada 12 Oct, 2023

Network Engineer Routing and Switching protocol like BGP and STP,VTP.VLAN,WAN. Working knowledge of NOC Monitoring Tools. Remote monitoring & management of Network infrastruct...
supporttroubleshootingconfiguringdata networkingverifying

Network Engineer Vishakhapatnam
VAYAM INFO SOLUTIONS PRIVATE LIMITED 0.00 to 5.00 Years Vishakhapatnam 12 Oct, 2023

Network Engineer Routing and Switching protocol like BGP and STP,VTP.VLAN,WAN. Working knowledge of NOC Monitoring Tools. Remote monitoring & management of Network infrastruct...
configuringtroubleshootingsupportticketing systemverifying

Acadamic Consultant
Pleasant Inc 0.00 to 4.00 Years Surat 12 Oct, 2023

To be successful in this role, you ll need to have the following skills: Integrity: As an AC, we entrust you with our Customer Resource Management (CRM) tool and sensitive student-related data. We...
resource managementEmployee Referral ProgramsProgramme Delivery

ADAS Senior_Developer_(C)_2023_MS/EDX7-XC
Bosch Group 0.00 to 4.00 Years Pune 12 Oct, 2023

Job Description Design & Implementation of in-house SIL (software in the loop) simulation tool for next generation Advanced Driver Assistance Systems for Situation Analysis area. Setting up and ...
situation analysissilscrumrunninganalysissimulationparticipationimplementationDifficult SituationsSituational AwarenessIntelligent AgentsCrisis SituationsCustomer RequirementsOrganizational CommitmentData Driven TestingStressful Situations

RPA Developer/ Consultant
Infosys Limited 0.00 to 2.00 Years Pune 12 Oct, 2023

Translate the customer s business requirements to define RPA (Robotic Process Automation) value proposition and solution scope Analyze client processes and identifies RPA opportunities. Recommend ...
test casessoft skillsprocess designprocess miningsolution designautomation toolsproject managerseffort estimationprocess automationcommunication skillswritten communicationbusiness requirementsproject administrationbotdesignminingtesting

Snow Developer
HCL Technologies Ltd 10.00 to 18.00 Years Noida 12 Oct, 2023

Dear Candidate, Greetings from HCL Tech.!! HCL is Hiring for SNOW Developer Minimum 8 years Relevant ServiceNow Experience. Responsible for handling escalations, participates in escalation mee...
angular jsjdbcjavascripthtmlcssservicenowsnow

Software Engineer
Quess Corp (Magna Infotech) 2.00 to 4.00 Years Mysore 12 Oct, 2023

<ul> Software Engineer Exp- 2 to 4years Np -15days to Immediate Mandatory skills Experience & working knowledge in SQL, Unix/Linux & RDBMS. Incident management tool S...
linuxinformaticasqlunixetl toolrdbms

Audit Manager
MULTI RECRUITERS 5.00 to 10.00 Years Kochi 12 Oct, 2023

Audit manager will be responsible for planning, assigning, and supervising the daily tasks given to other auditors in the organization. Audit Manager will help to train ...
audit managementstatutory auditexternal reportingaudit reportstax auditsinternal auditaudit professionalsaudit compliance

Internal Auditor
MULTI RECRUITERS 0.00 to 2.00 Years Kochi 12 Oct, 2023

Internal Auditor will be responsible for planning, assigning, and supervising the daily tasks given to other auditors in the organization. Audit Manager will help to tra...
audit managementstatutory auditexternal reportingaudit reportstax auditsinternal auditaudit professionalsaudit compliance

Content Design Dev-Ops
IBM India Pvt Limited 0.00 to 4.00 Years Kochi 12 Oct, 2023

Introduction At IBM, work is more than a job it s a calling: To build. To design. To code. To consult. To think along with clients and sell. To make markets. To invent. To collaborate. Not just to...
software development life cyclesoftware development toolsfront endbash scriptingcontent designagile developmentdevelopment toolsdigital conversionsoftware developmentsoftware engineeringintellectual propertywritten communicationstrategic initi

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Hyderabad 12 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Hotel Steward
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are looking for a hard-working steward to be responsible for ensuring all sanitation standards are met. The steward will attend to customer needs, assist wait staff, ensure all stations are we...
servicepressurereliabilitycommunicationteamworkmechanicalcustomerabilitiesdetailphysicalunderattentionproblem-solvingorganisationalabilitywork

Snow Developer
HCL Technologies Ltd 10.00 to 18.00 Years Delhi 12 Oct, 2023

Dear Candidate, Greetings from HCL Tech.!! HCL is Hiring for SNOW Developer Minimum 8 years Relevant ServiceNow Experience. Responsible for handling escalations, participates in escalation mee...
angular jsjdbcjavascripthtmlcssservicenowsnow

Hiring for QA Analyst - India
Morpheus Human Consulting Pvt Ltd 4.00 to 8.00 Years Delhi 12 Oct, 2023

Our client is a software development company specializing in web-development. What started in 2004 as a need of a custom software for a fulfillment warehouse to not only automate fulfillment oper...
quality assuranceqa testing

Home Lending Risk Strategic Analytics - Associate
JPMorgan 0.00 to 4.00 Years Bangalore 12 Oct, 2023

The HL Risk Strategic Analytics team spans the globe, primarily sitting in Plano, TX and Bengaluru, India, however we have staff and executive presences across 9 locations worldwide: Plano TX, C...
source system analysismusic makingloan servicingrisk managementcapital marketsdata manipulationstrategic analyticsrelational databasescompatibility testingfinancial justificationmissassqlriskstemtrustoraclecredit

Software Engineer
Quess Corp (Magna Infotech) 2.00 to 4.00 Years Bangalore 12 Oct, 2023

<ul> Software Engineer Exp- 2 to 4years Np -15days to Immediate Mandatory skills Experience & working knowledge in SQL, Unix/Linux & RDBMS. Incident management tool Servi...
linuxinformaticasqlunixetl toolrdbms

Hotel Steward
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Bangalore 12 Oct, 2023

We are looking for a hard-working steward to be responsible for ensuring all sanitation standards are met. The steward will attend to customer needs, assist wait staff, ensure all stations are we...
servicepressurereliabilitycommunicationteamworkmechanicalcustomerabilitiesdetailphysicalunderattentionproblem-solvingorganisationalabilitywork

HIRING FOR MAXIMO- APPLICATION DEVELOPER
Inspiration Manpower Consultancy Private Ltd 5.00 to 8.00 Years Bangalore 12 Oct, 2023

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming

Administration Head
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 7.00 Years Vishakhapatnam 10 Oct, 2023

Administrators support the smooth running of offices by carrying out clerical tasks and projects. As an administrator in the construction industry, you could be organising project meetings. Youd ...
communication skillstime managementpersuasionpeople skillsdecision-makingmultitaskingorganizational skillscomposureproblem-solving

Software Engineer
AVHAD ENTERPRISES 9.00 to 14.00 Years Pune 10 Oct, 2023

We are looking for a skilled software engineer who, along with our excellent software development team, will be responsible for working on projects that are currently being developed on by our co...
engineering changessoftwaresoftware quality assuranceengineering change managementtelecomsoftware engineeringsoftware testinggeneralbom developmentsoftware design

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Mumbai City 10 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Gurugram 10 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Identity Access Management (IAM) Security Engineer
Accenture 4.00 to 6.00 Years Gurugram 10 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
firewallnetworkingcustomer relationsidspenetration testingapplication serverenterprise systemsprofessional servicesidmjavacloudcybervisitdesignsecuritybusinessstrategysafeguardoperations

Senior Consultant - Data Management & Governance Delhi
MAZENET SOLUTION PRIVATE LIMITED 6.00 to 10.00 Years Delhi 10 Oct, 2023

Data Management and Governance Rolein Banking Domain We are looking to hire Sr. Consultant/Manager who possesses 6 to 10 years of experience as per below JD - <...
data governancecredit risk

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Bangalore 10 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Tech Lead, Software Development Engineering
Fiserv India Pvt Ltd 9.00 to 11.00 Years Chennai 10 Oct, 2023

Calling all innovators find your future at Fiserv. We re Fiserv, a global leader in Fintech and payments, and we move money and information in a way that moves the world. We connect fina...
javascriptjavamysqlhtmlapiobject oriented designsql server 2008sql serverpostingfortune 500social mediaweb servicesunit testingsecure codingproduct supportproblem solvingdesign patternscustomer serviceproject managers

Process Engineer
Alstom Transport India Ltd 3.00 to 7.00 Years Nagpur 06 Oct, 2023

Req ID:433878 Leading societies to a low carbon future, Alstom develops and markets mobility solutions that provide the sustainable foundations for the future of transportation. Our product po...
process engineeringsafetytroubleshootingqualitydocumentationms office toolsproject life cyclecontinuous improvement facilitationms officelife cycleroot causelow carbonline balancingtooling designbusiness processenglish languageproject exec

Applications invited for RA position at AIPH
Amity University 2.00 to 4.00 Years Noida 06 Oct, 2023

Applications invited for RA position at AIPH - 03-05-2023 - Adv/AUUP/HR/23/229 Advertisement Date: 03-05-2023 Adv/AUUP/HR/23/229 Amity Institute of Public Health Invites Applications for Research ...
fundingwritingproject managementanalysis

Team Leader
RISEOM TOOL CRAFTS PRIVATE LIMITED 4.00 to 9.00 Years Mumbai City 06 Oct, 2023

A team leader provides guidance and instruction to a working group about a project or portfolio of projects. They are in charge of delegating work, overseeing progress towards go...
organisational alignmentproblem solvinginterpersonal communicationcritical thinkingorganizingemotional intelligencetime managementleadinggoalsworkcommunicatingtrustworthinessexample

Urgent hiring for Mechanical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Hyderabad 06 Oct, 2023

Job Description Mechanical Engineer Educational Qualification: BE / B.Tech in Mechanical Job Types : Freshers, Experienced Skill : AutoCAD Salary : Rs.25,000/- to 50,000/- Mechanical Engin...
production engineeringproduction planning controldesign engineeringquality control

Vacancy for Senior Lead Engineer- Electrical & Electronics
Mahindra business & consulting services pvt ltd 14.00 to 16.00 Years Chennai 06 Oct, 2023

Responsibilities & Key Deliverables - Create technology roadmaps in the areas of Body Electronics & Vehicle security Systems - Bring in New Feature related...
root causecommissioningsalesautocaddrawingequipment supply

SAP PP/QM Consultant
Infosys Limited 6.00 to 8.00 Years Chennai 06 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to lead the engagement effort of providing high-quality and value-adding consulting solutions t...
bill of materialsstrong business acumenclient interfacing skillsmaterial requirement planningsoftware configuration managementcontinuous improvement facilitationmaster datateam managementproblem solvingsolution designbusiness acumenchange manag

SAP PP/QM Consultant
Infosys Limited 0.00 to 1.00 Years Chandigarh 06 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to actively aid the consulting team in different phases of the project including problem defini...
bill of materialsmaterial requirement planningcontinuous improvement facilitationmaster dataproblem solvinganalytical skillsvendor evaluationeffort estimationquality managementprocess inspectiontechnology solutionsmaterial requirementrequireme

Application Architect SAP HANA Development
IBM India Pvt Limited 0.00 to 4.00 Years Bangalore 06 Oct, 2023

Introduction In this role, you ll work in one of our IBM Consulting Client Innovation Centers (Delivery Centers), where we deliver deep technical and industry expertise to a wide range of public a...
javasapreportingapisap hanaprivate sectorleadership skillscommercial modelscorporate liaisonoptimization strategiesapplication architecturesqlcdshanabaphananativeconsoleobjects

HMC Operator
POST A RESUME 4.00 to 6.00 Years Ahmedabad 06 Oct, 2023

-ITI, diploma or equivalent with 4-6 years of experience operating HMC production machine shop. - Hand on Experience of HMC Operating. - Setting knowledge of HMC. - ...
hmc fanuc control programminghmc production machine shop

CNC Turning Operator
POST A RESUME 4.00 to 6.00 Years Ahmedabad 06 Oct, 2023

-ITI, diploma or equivalent with 4-6 years of experience operating CNC Turning production machine shop. - Hand on Experience of CNC Turning Operating. - Setting knowl...
cnc turningcnc turning toolingcnc turning operator

Vmc Operator
POST A RESUME 4.00 to 6.00 Years Ahmedabad 06 Oct, 2023

-ITI, diploma or equivalent with 4-6 years of experience operating VMC Machine in production machine shop. - Hand on Experience of VMC Operating. - Setting knowledge ...
vmc machinevmc operatingvmc operator

Design & Production Engineers
BOYEN HADDIN CONSULTING AND TECHNOLOGY PRIVATE LIMITED 5.00 to 10.00 Years Pune 04 Oct, 2023

Develop concepts through to production, to ensure robust, cost-sensitive design solutions.

lighting designdesign engineering

Team Lead
Infosys Limited 2.00 to 4.00 Years Pune 04 Oct, 2023

Responsibilities: Support the team lead in monitoring and executing day to day document controller and engineering data queries and activities. Maintaining strong relationships with business partn...
master data managementservice center operationsmaster datagas industrydata standardsdata managementcustomer servicequality measuresquality assuranceprocess managementstrategic thinkingposition managementcontinuous improvementrelationship mana

Process Specialist
Infosys Limited 0.00 to 1.00 Years Pune 04 Oct, 2023

Responsibilities: Ensure the accurate and timely delivery of tag validations & data extraction from engineering documents. Ensure document data is consistent with the tag register data. Validate t...
sapslacustomer relationsqualityreportingsupply chaindata extractioncustomer servicedocument controlquality measuresquality assuranceposition managementengineering drawingsproject documentationaccount administrationengineering documentation

Software Engineer
AVHAD ENTERPRISES 9.00 to 14.00 Years Noida 04 Oct, 2023

We are looking for a skilled software engineer who, along with our excellent software development team, will be responsible for working on projects that are currently being developed on by our co...
engineering changessoftwaresoftware quality assuranceengineering change managementtelecomsoftware engineeringsoftware testinggeneralbom developmentsoftware design

PREV
NEXT

tool Job Openings

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific... application developmentapplication programming

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Job Key Responsibilities : -Having 6-8 years of experience in Maximo java customization -Technical/Functional expertise on more than one of Industry Specific...
application developmentapplication programming