Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Should be Senior Developer or Technical Architect in current organization Should have in - depth knowledge and experience in following: .Net development and deployment (C# , Web Services , WCF , J...
net technicalarchitecture sql wcfservices web wcf webservices json etdeveloper developerDot Net Developers / Team Leads / Tech. Leads a Business Analyst (2 Vacancies) A Dot Net Developers / Team Leads / Tech. Leads Experience: Minimum 2- 10 years Job Location: Vadodara Bangalore Descri...
sqlserver net jquery javascript html webservices wcfservices webapplications businessanalysis projectadministration sql net wcf git dot soap linq spnetmvc entityframewASP.NET Developer Required Fulltime ASP.NET Developer with 2+ years of experience No. of Openings: 2 Total Experience: 2 Year and above Location: Mumbai,...
LanguageIntegratedQuery WindowsCommunicationFoundation EntityFramework Silverlight WCFServices WinForms spnet ADONET ASPNETAJAX ASPNETMVCASP.NET Developer Required Fulltime ASP.NET Developer with 2+ years of experience No. of Openings: 2 Total Experience: 2 Year and above Location: Mumbai,...
LanguageIntegratedQuery WindowsCommunicationFoundation EntityFramework Silverlight WCFServices WinForms spnet ADONET ASPNETAJAX ASPNETMVCKey skills required for the job are:
Asp.net Core Developer Job description: Candidate should be Desired skills: Asp.net , C# Experience: 1 Years Education: B.Tech No. Of Openings: 4 Location: Lucknow Application Last Date: Sunday...
LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF msASP.NET Developer Required Fulltime ASP.NET Developer with 2+ years of experience No. of Openings: 2 Total Experience: 2 Year and above Location: Mumbai,...
LanguageIntegratedQuery WindowsCommunicationFoundation EntityFramework Silverlight WCFServices WinForms spnet ADONET ASPNETAJAX ASPNETMVC3+ yrs Software Developer Programmer (Microsoft Technologies). Developing web- based/ Desktop applications and client- server applications using ASP.NET 3.5, ASP.NET 4.0, C#.NET, ADO.NET, LINQ7, MVC...
finance wcf dot sdlc desktop retail design extraction net ssetsrecovery webtechnologies cnet clientserver wcfservices aspnet aspnet35 telerikcontrols adonetRequired software developer who is good in below skills 1) Technical a. ASP.NET and C# b. JavaScript/ JQuery c. HTML/ CSS d. BE.,...
sqlserver javascript jquery html sql software LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices BusinessServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF msProfile :- Asp.Net Developer Fresher Experience -Fresher Designation :- Trainee Developer Skill :- Microsoft stack (MS SQL Server, IIS, .NET framework, ASP.NET, ADO.NET, C# or VB.NET, WCF Ser...
sqlserver wcfservices userexperience webapplications programminglanguages sql xml iis wcf net ajax salary jquery vbnet testing software etframework aspnet adonetJob: Asp.Net | Consultancy Services, Web Development, SEO Services, Job Information Summary:- 1. MUST HAVE computer science education. 2. Must have minimum of 4 years of experience in C#, SQL serve...
wpf sql seo ci php wcf oftwaredevelopment webapplication corporatetraining consultancyservices wcfservices webdevelopment communicationskills sqlserver coldfusion trainingneeds computerscienceJob Summary: Prolifics is seeking an experienced engineer who will be responsible to developing and maintaining the accelerators and utilities used by our testing team. The accelerators are built us...
sqlqueries wcfservices webdevelopment sql net wcf java net ajax jquery testing writing research utilities EnterpriseManager QueryDesigner MSQuery edprocedures msnet aspnetThe primary role of the .Net Developer is to work alongside senior and junior team members to support custom .net projects. Responsibilities: Responsible for custom .net projects, which includes r...
sqlserver net jquery javascript html webservices wcfservices webapplications javascriptlibraries continuousintegration ug soa wcf oops linq rdbms tools entityframewWe having urgent opening with one of our reputed client for the requirement of Sitecore based in greater Noida Location. JD: Exp: 3- 10 Y Mandatory Skills-Sitecore, Sitecore migrat...
sitecore LanguageIntegratedQuery WindowsCommunicationFoundation EntityFramework Silverlight WCFServices WinForms TelligentCommunityServer Ektron Umbraco Kentico spnet ADONET ASPNETAJAX ASPNETMVC Sitefinit02 Software Developer - Experience: 1-3 Years - No. of openings: 10 - Job location: Surat and Ahmedabad - Qualification: MSc.IT, MCA, BEIT, or Equivalent CANDIDATE MUST BE PROFICIENT IN FO...
sqlserver javascript jquery html sql mssql wcfservices mq api wcf bus oops soap linq rest mysql redis rabbit spnetmvc entityframew4 to 6 years of proven working experience in web and server side programming. Expertise in ASP . Net MVC, WebAPI, WCF, JS, Jquery, REST Top notch programming skills and in- depth knowledge in . Ne...
java environment sqlserver sql customerrelations clientsidescripting testdrivendevelopment object webapplicationdevelopment serverside clientside wcfservices webapplication entedprogramming computers2 - 4 years working experience in web and server side programming. Working knowledge in ASP . Net MVC, WebAPI, WCF, JS, Jquery, REST Hands on experience in . Net development- C#, ASP. Net, MVC, MV...
responsivewebdesign clientsidescripting testdrivendevelopment object sqlserver serverside clientside wcfservices webapplication computerscience webtechnologies databasesystems entedprogramming weHello, Greetings from Forret India.!! We are a placement firm based in India and we have the good exposure in international Market. Kindly find the below job description for current openings: Comp...
sqlserver ssis aspnet mvc wcfservices wcf nunit arketcomm webapi microsoftnetRequired Fulltime ASP.NET Developer with 1+ years of experience No. of Openings: 1 Total Experience: 1 Year and above ASP.NET Developer / Sr. Developer - MVC - Simplified Software Solutions India C...
wcfservices silverlight wpf ajax wcf oops designpatterns mvc etdeveloper entityframewYou ll be playing a key role in the design, testing and maintenance of software systems. The programs you create are likely to help businesses be more efficient and provide a better service. You will ...
webservices mssql designpatterns net wcfservices wcf sqlserver icrosoftnet sqlplsql ll3+ yrs Software Developer Programmer (Microsoft Technologies). Developing web- based/ Desktop applications and client- server applications using ASP.NET 3.5, ASP.NET 4.0, C#.NET, ADO.NET, LINQ7, MVC...
design architecture bootstrap desktop retail net wcf telerik software net aspnet35 aspnet adonet wcfservicesWe are looking for Dot Net Developer at client side in Airoli (Navi Mumbai) For 5+ yrs experience need team handling role in current organization. Insurance domain experience preferred first. Role :...
c#.net c# wcf asp.net sql spnet dotnet sqlserver .netdeveloper wcfservices dotnetdeveloper csharpAbout Accenture: Accenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and entertai...
rest javascript java sqlserver webservices wcfservices servlets jsp qlplsqlOpening For Dot Net Developer in Hyderabad Location Designation: Dot Net Developer Experience: 5 to 7 yrs (MVC, WCF Services, DB are must) Salary:Hike on Current Location: Hyderabad ,...
net wcfservices wcf mail sqlserver net mvc qlserver aspnetPCIIL_0000087490_1 DotNet Sr. Developer BANGALORE Job Description Dot.net Developer ( Vb.Net & WPF ) Exp: 3 yrs. to 7 Yrs. Notice: 15 Day to 30 Days Max Work Location: Bangalore Job Descriptio...
wcfservices wpf wcf web pattern mvvm webservices etdeveloper framew developerJob: Asp.Net | Consultancy Services, Web Development, SEO Services, Job Information Summary:- 1. MUST HAVE computer science education. 2. Must have minimum of 4 years of experience in C#, SQL serve...
wpf sql seo ci php wcf oftwaredevelopment webapplication corporatetraining consultancyservices wcfservices webdevelopment communicationskills sqlserver coldfusion trainingneeds computerscienceJob: Application Support Engineer | Consultancy Services, Web Development, SEO Services, Job Information 1. MUST HAVE computer science education. 2. Must have minimum of 3 years of experience in .Net...
linux troubleshooting unix sql ebdevelopment trainingneeds sqlserver qatesting phasei designpatterns technicalskills wcfservices managementskills corporatetraining productionsupport computerscienceAsp.net Core Developer Job description: Candidate should be Desired skills: Asp.net , C# Experience: 1 Years Education: B.Tech No. Of Openings: 4 Location: Lucknow Application Last Date: Sunday...
LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF msSoftware Developer Job description: tyguhjk Desired skills: Asp.net , C# Experience: 2 Years Education: B.Tech No. Of Openings: 2 Location: Lucknow Application Last Date: Thursday , 19 July 201...
sqlserver javascript jquery html sql software LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices BusinessServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF msRequired software developer who is good in below skills 1) Technical a. ASP.NET and C# b. JavaScript/ JQuery c. HTML/ CSS d. BE.,...
sqlserver javascript jquery html sql software LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices BusinessServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF ms4 year s industry experience in .NET web application development using the following technologies Required Experience with Microsoft MVC framework Strong SQL skills Experience with development of ...
javasqljavascriptsqlserverjquerywebapplicationdevelopmentwcfserviceswebapplicationapplicationdevelopmentwcfnetsoapsoftwareangularjscommunicationangularDesktopApplicationDevelopmentatabasedriveReview and validate client requirements based on technology knowledge/ expertise and understanding of the client s business process and challenges Define organization-wide technology direction and ro...
mssqlserversoftwareconfigurationmanagementmssqlsqlserverwebserviceswcfservicestechnicaldesignbusinessprocessqualityassurancemobiledevelopmentclientrequirementsetwksecuritybusinessrequWe urgently require B.Tech (CSE) Fresher Who wants to start their career in ASP.NET For more detail please call us: 9779967173 Note:- 1. This is full time job only 2. Candidates of Chandigarh regio...
winformssilverlightado.netsp.netajaxwcfservicesentityframeworkasp.netmvcwindowscommunicationfoundationlanguageintegratedqueryWe urgently require B.Tech (CSE) Fresher Who wants to start their career in ASP.NET For more detail please call us: 9779967173 Note:- 1. This is full time job only 2. Candidates of Chandigarh regio...
winformssilverlightado.netsp.netajaxwcfservicesentityframeworkasp.netmvcwindowscommunicationfoundationlanguageintegratedqueryJOBDESCRIPTION Lucknow, Uttar Pradesh15,000 - 25,000 a month1+ years experience Job Summary -Good knowledge of Asp.Net -Strong C# Knowledge -Ajax and JQuery-SQL Server 2008 and above -JSON /XML/ Java...
javascriptjquerysqlxmlasp.netjsone-governancexslnetframeworkwcfservices" We are Looking for Asp.net Developer for a Good Growing Company. Candidate Should Be Graduate., "...
LanguageIntegratedQuery WindowsCommunicationFoundation Silverlight WCFServices spnet ADONET ASPNETAJAX EntityFramew ASPNETMVC WinF msWe are hiring for leading IT company in West Delhi (JanakPuri). Details are Below: Designation: Software Engineer (.Net Developer) Required Experience: 3 to 5 Years relevant experience Educational ...
webservicesngularjsasp.netmvcwcfservicessqlserverentityframeworkNet Architect(Solution & Technical) 1. Net Framework 4.0 2. Experience on Architecting , design , development on MS Platform 3. Ability to take calls on Technology selection 4. Excellent knowledge...
sqlserverwcfserviceswebtechnologiessqlnetwpfaspwcfjavanetdesignjquerywindowsspnetaspnetmvcclientsidedesigndevelopmentedmaspnetNet Architect(Solution & Technical) 1. Net Framework 4.0 2. Experience on Architecting, design, development on MS Platform 3. Ability to take calls on Technology selection 4. Excellent knowledge o...
sqlserverclientsidewcfserviceswebtechnologiesdesigndevelopmentsqlnetwpfwcfedmjavanetdesignjquerywindowsdeploymententerprisespnetmvcaspnetJob Description .Net Architect(Solution & Technical) 1. Net Framework 4.0 2. Experience on Architecting, design, development on MS Platform 3. Ability to take calls on Technology selection 4. ...
sqlserverwcfserviceswebtechnologiesmvcarchitecturesqlnetwpfwcfjavanetedgedesignjqueryspnetmvcclientsidedesigndevelopmentedmoffersaspnetWe urgently require B.Tech (CSE) Fresher Who wants to start their career in ASP.NET For more detail please call us: 9779967173 Note:- 1. This is full time job only 2. Candidates of Chandigarh regio...
silverlightado.netwinformssp.netajaxasp.netmvcwindowscommunicationfoundationentityframeworkwcfserviceslanguageintegratedqueryOpening For Dot Net Developer in Hyderabad Location Designation: Dot Net Developer Experience: 5 to 7 yrs (MVC, WCF Services, DB are must) Salary:Hike on Current Location: Hyderabad ,...
netwcfserviceswcfmailsqlservernetmvcqlserveraspnetCandidate should have 7-9 year of experience VB.net nd Microsoft development skil set N/A Additional Information Bonus Eligibility
Gender : Male / female Industry : IT Job Responsibilities: Our client is seeking a .NETdeveloper who are responsible for building .NET applications using ASP.NET, C#, MS- SQL, Power BI and all Micr...
powerbiusecasesopensourcewebservicessqldatabasewcfservicesproblemsolvingwebapplicationqueryoptimizationoptimizationstrategiesautomatedtestingmicrosoftsqlollabativeproblemsolvingNet Architect(Solution & Technical) 1. Net Framework 4.0 2. Experience on Architecting, design, development on MS Platform 3. Ability to take calls on Technology selection 4. Excellent knowledge o...
sqlserverclientsidewcfserviceswebtechnologiesmvcarchitecturedesigndevelopmentsqlnetwpfwcfedmjavanetdesignjquerywindowsdeploymentspnetmvcaspnetHi Dear aspirants, Greetings from Rubitech Global Solutions Pvt Ltd.! We have Immediate openings in ASP.Net with MVC Here is the MVCASP.NET Developer Mainly MVCASP.NET Developer job description...
winformsado.netasp.netonqopeningsmanagementsilverlightclosingssp.netmvcasp.netajaxculinarymanagementgrandopeningswindowscommunicationfoundationmenuengineeringwcfservicesmediterraneancuisinelanguageintegratedqueryroomsdivisionmanagementOpening For Dot Net Developer in Hyderabad Location Designation: Dot Net Developer Experience: 5 to 7 yrs (MVC, WCF Services, DB are must) Salary:Hike on Current Location: Hyderabad ,...
netwcfserviceswcfmailsqlservernetmvcqlserveraspnetASP.NET Developer Required Fulltime ASP.NET Developer with 2+ years of experience No. of Openings: 2 Total Experience: 2 Year and above Location: Mumbai,...
SilverlightWCFServicesspnetADONETASPNETAJAXLanguageIntegratedQueryWindowsCommunicationFoundationEntityFramewASPNETMVCWinFHi Dear aspirants, Greetings from Rubitech Global Solutions Pvt Ltd.! We have Immediate openings in ASP.Net with MVC Here is the MVCASP.NET Developer Mainly MVCASP.NET Developer job description...
winformsado.netsilverlightasp.netmanagementoomsdivisionmanagementmenuengineeringonqasp.netajaxculinarymanagementwindowscommunicationfoundationclosingsasp.netmvcwcfserviceslanguageintegratedquerygrandopeningsentityframeworkopeningsopeningDear Candidate, Greetings from KAN Infocom Solutions Pvt. Ltd. We have multiple openings forSoftware Developer/ASP.Net developerwith MVC& WCF for our Mumbai based client who is a reputed banking fir...
jquerywcfcss3mvchtmlnetwithmvcwcfserviceswebapplicationswebservicesdevelopmentmvcarchitecture.netdeveloperasp.netc#asp.net3.5softwaredevelopement© 2019 Hireejobs All Rights Reserved