workflow adaptability jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

workflow adaptability Job Openings

Showing 4401 - 4450 of 4693 Jobs

Manufacturing Engineer DIPLOMA ,B TECH

Manpower Solution Fresher Delhi 23 Oct, 2023

Manufacturing Engineer Job Description Template: We are looking for a talented manufacturing engineer to oversee and improve manufacturing ...
manufacturing processmanufacturing execution systemmanufacturing operationsmanufacturing engineeringmanufacturing managementmanufacturing

Support Engineer III

Amazon 2.00 to 4.00 Years Chennai 23 Oct, 2023

SAP ABAP

Infosys Limited 0.00 to 2.00 Years Bangalore 23 Oct, 2023

Data Scientist

Quess Corp (Magna Infotech) 5.00 to 10.00 Years Bangalore 20 Oct, 2023

Oracle EBS Apps technical Finance

LTIMindtree Limited 6.00 to 9.00 Years Mumbai City 18 Oct, 2023

Skill -Apps Technical Finance
Location PAN INDIA
Years of Experience 6to 9 Yrs

cash management

general ledger

oaf

oracle apps technical

oracle application framework

Port Captain - Mumbai (Nhave Sheva)

Busisol Sourcing India Private Limited Hiring For A Leading Shipping Company 10.00 to 12.00 Years Mumbai City 18 Oct, 2023

Master Marine
With 10-12 years of Experience

JOB DESCRIPTION

port operations

terminal operations

master mariner

Biostatistician

FAST FREEDOM LIFE PRIVATE LIMITED 2.00 to 7.00 Years Mumbai City 18 Oct, 2023

stakeholder management

quantitative analysis

Professional, Accounts Payable

Fiserv India Pvt Ltd 0.00 to 4.00 Years Gurugram 18 Oct, 2023

Calling all innovators find your future at Fiserv.

Siebel Tester

LTIMindtree Limited 6.00 to 10.00 Years Delhi 18 Oct, 2023

Experience:

Location:

Detailed description:

Oracle EBS Apps technical Finance

LTIMindtree Limited 6.00 to 9.00 Years Delhi 18 Oct, 2023

Skill -Apps Technical Finance
Location PAN INDIA
Years of Experience 6to 9 Yrs

cash management

general ledger

oaf

oracle apps technical

oracle application framework

Biostatistician

FAST FREEDOM LIFE PRIVATE LIMITED 2.00 to 7.00 Years Delhi 18 Oct, 2023

stakeholder management

quantitative analysis

Salesforce Architect or Salesforce Technical Lead

HCL Technologies Ltd 5.00 to 10.00 Years Chennai 18 Oct, 2023

Role Name

Heavy Construction Manager

AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Pune 16 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Maintenance Supervisor

RISEOM TOOL CRAFTS PRIVATE LIMITED 4.00 to 9.00 Years Pune 16 Oct, 2023

ensuring that all building systems, equipment, and facilities in their charge operate at peak efficiency

Agency Manager A Leading life insurance company

MITRAM MANPOWER SOLUTION PRIVATE LIMITED 1.00 to 6.00 Years Hyderabad 16 Oct, 2023

agency sales

field sales

sales

insurance agency management

banking sales

agency development

casa sales

Maintenance Supervisor

RISEOM TOOL CRAFTS PRIVATE LIMITED 4.00 to 9.00 Years Noida 16 Oct, 2023

ensuring that all building systems, equipment, and facilities in their charge operate at peak efficiency

Senior Process Executive

Infosys Limited 0.00 to 1.00 Years Chennai 16 Oct, 2023

Executive Development

Hiring

Leadership Development

MultiUnit

Customer Support Associate

The Job Factory Fresher Bangalore 16 Oct, 2023

Openings for Bpo Jobs

Job Responsibilities :

Answer inbound customer calls.
kannadatamil

Sap Wm Consultant

V tech it solutions 0.00 to 3.00 Years Vishakhapatnam 12 Oct, 2023

Hi Job Seekers,

We have a job opening for SAP WM entry level fresher consultants to our Reputed MNC Client Companies with Remote Locations.

Positions -...
tape storagebroadcast standardstape managementreverse logisticsflip factoryproductionpathfiretapeless workflow

Salesforce Architect or Salesforce Technical Lead
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! We are hiring for the below job role in HCL Technologies Pvt Ltd. India Location : Pune/Noida/Hyderabad/Chennai/Bengaluru Role Name: SFDC Lead/SFDC Archite...
force.comapex data loadersfdcsalesforcesalesforce crm

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Mumbai City 12 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Mumbai City 12 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

Salesforce Architect or Salesforce Technical Lead
HCL Technologies Ltd 5.00 to 10.00 Years Mumbai City 12 Oct, 2023

Hi All, Greetings! We are hiring for the below job role in HCL Technologies Pvt Ltd. India Location : Pune/Noida/Hyderabad/Chennai/Bengaluru Role Name: SFDC Lead/SFDC Archite...
force.comapex data loadersfdcsalesforcesalesforce crm

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Hr Generalist
Big Bee Consultant 3.00 to 5.00 Years Noida 12 Oct, 2023

Job Opening : HR Generalist

Location : Noida Sec -5

Supervisory Responsibilities:

May...
hr operationshr generalist activities

Salesforce Architect or Salesforce Technical Lead
HCL Technologies Ltd 5.00 to 10.00 Years Delhi 12 Oct, 2023

Hi All, Greetings! We are hiring for the below job role in HCL Technologies Pvt Ltd. India Location : Pune/Noida/Hyderabad/Chennai/Bengaluru Role Name: SFDC Lead/SFDC Archite...
force.comapex data loadersfdcsalesforcesalesforce crm

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Chennai 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Bangalore 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Sales Development Manager
TEKPILLAR 2.00 to 6.00 Years Ahmedabad 12 Oct, 2023

Summary: As a Sales Development Manager, you will oversee a high-performing sales team while increasing client satisfaction and revenue in our flourishing BFSI and insurance divi...
insurancemarketingmanagementsalesbfsileadpaymentfmcg

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Pune 10 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Noida 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

Trust & Safety New Associate-Content Management
Accenture 0.00 to 1.00 Years Hyderabad 10 Oct, 2023

Skill required: Content Management - Content Moderation Designation: Management Level - New Associate Job Location: Hyd...
accounts payableaccounts payablereceivableapproval processbudgetingcreditsocial trendsonline contentproblem solvingcurrent affairsresolving issuesinternet researchcritical thinkingtraining programscontent managementprofessional services

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Hyderabad 10 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Hyderabad 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Gurugram 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

SailPoint IIQ Sr. Consultant Gurugram
Shell Info Technologies Pvt Ltd 3.00 to 8.00 Years Gurugram 10 Oct, 2023

Skill - SailPoint Sr. Consultant and Consultant Position Positions - 20 Experience: 3- 8 Years Work Mode: Hybrid Need to work fromHyderabad/ Bangalore/ Noida/Chennai/Gurgaon/Pune/ Kolkata OFFIC...
oauthsoapjsonrestsailpoint identityiq

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Delhi 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Chennai 10 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Chennai 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

Automation Developer
JPMorgan 3.00 to 9.00 Years Bangalore 10 Oct, 2023

Job Responsibilities:

Perform requirement gathering, analysis, design, development and implementation of new workflow needs

Partner with business, product owner and key stakeho...
automationjavaagileqa automation

Assistant Manager
Infosys Limited 4.00 to 9.00 Years Bangalore 10 Oct, 2023

hard core AP domain expert - must have good SAP knowledge excellent in Accounts Payable domain skills shld have good understanding of e2e AP skills.right from PO creation till payment of invoices ...
salesmisaccountstatbankingvendor masteraccounts payableequipment supplyinvoice processingcommunication skillsbposaphisvime2esla

EBS Apps Technical with Apex
LTIMindtree Limited 6.00 to 11.00 Years Bangalore 10 Oct, 2023

Oracle EBS Apps Technical with Apex Experience-5 to 12 years Location -Pan India(LTIMindtree) Notice period0-60 Days Oracle Apps EBS R12 Technical Consultant with strong Technical Skills APE...
ebsoracleappstechnicalapex

Fixed Day shifts
Wroots Global Private Limited 0.00 to 4.00 Years Bangalore 10 Oct, 2023

Hi, HR SARA @WROOTS We are looking for a Call Center Representative for international and domestic processes that will be the liaison between company and its current and potential customers. The...
customer servicevoice processvoiceinboundbpocustomer carecustomer support

Teamcenter Senior Developer
Bosch Group 5.00 to 8.00 Years Pune 06 Oct, 2023

Job Description Position : Teamcenter Senior Developer Location: Pune JD: Teamcenter Senior Developer 5-8 years experience in Design & Implement Teamcenter solutions (11.x, 12.x & 13.x) as per...
javajquerysql serversqlenvironmentweb servicessoa servicesquery builderbom managementsolution designchange managementworking experienceserver architecturesapxmlplmsoabom

Accountant - Finance and Accounting
QUATRRO BUSINESS SUPPORT SOLUTIONS PRIVATE LIMITED 2.00 to 4.00 Years Gurugram 06 Oct, 2023

About Quatrro Business Support Services (Quatrro) QBSS is a tech-enabled outsourcing firm thats changing the way companies think about finance, accounting, human resources and t...
erpaccountingoracle

Accountant - Finance and Accounting
QUATRRO BUSINESS SUPPORT SOLUTIONS PRIVATE LIMITED 2.00 to 4.00 Years Mumbai City 06 Oct, 2023

About Quatrro Business Support Services (Quatrro) QBSS is a tech-enabled outsourcing firm thats changing the way companies think about finance, accounting, human resources and t...
erpaccountingoracle

Crm Executive
Talent Corner HR Services Pvt Ltd 0.00 to 3.00 Years Mumbai City 06 Oct, 2023

Dear Candidate, I am sending you thejob description in below attachment Job Title: Customer Relationship Executive Location: Santacruz, Mumbai Salary- upto 20000 per month Experience minimum...
voice processcustomer support

Team Leader Recruitment
BOYEN HADDIN CONSULTING AND TECHNOLOGY PRIVATE LIMITED 4.00 to 8.00 Years Mumbai City 06 Oct, 2023

Managing Day to day operations of assigned Key Accounts

Planning Workflow of Recruiter
...
recruitmentteam leadership

PREV
NEXT

workflow adaptability Job Openings

Manufacturing Engineer Job Description Template: We are looking for a talented manufacturing engineer to oversee and improve manufacturing ... manufacturing processmanufacturing execution systemmanufacturing operationsmanufacturing engineeringmanufacturing managementmanufacturing

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Job Opening : HR Generalist

Location : Noida Sec -5

Supervisory Responsibilities:

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Manufacturing Engineer Job Description Template: We are looking for a talented manufacturing engineer to oversee and improve manufacturing ...
manufacturing processmanufacturing execution systemmanufacturing operationsmanufacturing engineeringmanufacturing managementmanufacturing

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical