Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Opportunities that we offer: Work on the latest Microsoft technologies. Grow with us - professionally and personally. Explore ground transportation & travel domain, and work with the renowned trave...
reporting toolsanalytical skillsstored procedurescommunication skillsprogramming conceptsground transportationobjectoriented programmingMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
invoice processingsupply chainsap projectssqljavascriptjquerytravel managementsql serversap mmit budgetingjavasap ficoproblem solvingMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
it budgetinginvoice processingsql serversap ficocareer developmentsqlsap projectsproblem solvingsap mmtravel managementfinancial justificationsupply chainjqueryjavascriptjavasapMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
javaproblem solvingjavascriptcareer developmentsap projectsfinancial justificationsqlinvoice processingcustomer relationssap ficosap mmit budgetingsupply chainsql servertravel managementNorth Indian Chef Experience Required: 1+ year Location:- Gurgaon Job Responsibilities :- Specialization North Indian Food and Tandoori. Both Veg and Non Veg Should know all north indian dishes, ho...
kitchencookingdeliveryleadershipfoodMenu DevelopmentFine DiningBanquet OperationsRecipe DevelopmentMenu CostingMenu EngineeringCateringGame Programmer will be responsible for developing assigned tasks while collaborating with other teams on the project. Job Responsibilities: Follow best practices for coding and co-ordinate regular ...
androidgame developmentjavaiosproblem solvingmathstamilgamesopenglphysicsconsoledirectxcommandreportingdebuggingAccounts Executive CA or Inter CA only Good English - Written and oral Experience: 1-2 years Working Location: Ahmedabad To prepare the Financial statements of clients from the information provid...
tdsbank reconciliationsalesaccountsaccountinggeneral ledgergeneral accountingfinancial statementsfinancial justificationFONDANT CHEF (GOOD WITH ART WORK AND FIGURINES) 1 TIME FOOD PROVIDED Responsibilities for FONDANT CHEF
Educational Details: B.COM City: Oragadam State: chennai PostalCode: 603109 Notice Period: 30 Days Rec...
petty cashbudgetingreportingpetty cash maintenanceaccountingtally erp 9worderpsalestally erpfinanceaccountsattendance maintenancecomattendancetallyexcelexpensesunloadingcashJob Title : Digital Marketing Specialist (Female) Job Location : Ahmedabad, Gujarat Vacancy : 1 Salary Budget : According to market Anyone can located in Ahmadabad or willing to relocate Experien...
google analyticsmarketingresearchweb site productioncontent managementsocial mediaemail marketingmicrosoft officedigital marketingcontent marketingmeasurement toolsmarketing campaigns
Sales executive: job description
Need back office executive * data manage * Computer knowladge * Comunication Skill City: Ahmedabad State: Gujarat PostalCode: 380052 R...
missalesdata entrycustomer relationsmicrosoft excelback officeMiddle OfficeSettlementGlobal CustodyCorporate ActionsEuroclearSecurities Lending=========== Job Descriptions for PHP Experience Resource========== PHP
1 .Net Developer WPF (desktop based) (experience required: 3+ years) (C#.NET, WPF) (2 openings) Wpf technology would be an added advantage. We can consider someone who is technically strong in C#.net ...
reporting toolsanalytical skillsstored proceduresprogramming conceptsground transportationwpfwcfnetlinqmvvmtsqldesigntestingwindowstelerikrunningobjectoriented programming Hiring Application Developer (Full Stack Developer) For Middle & Senior Level.
Location Autonagar, Vijayawada.
Nature of job On-site role.
1.Understand the concept of the furniture design from the 2D drawing. 2. Drafting measurement layouts, furniture layouts all detail drawings 3. Daily coordination with the office design team members a...
google sketchupcadfurniture designdraftingms officeproject handlingsketchupdrawingautocad drawinginterior designingdesignoutputportfoliofurnitureslaautocadcomputeraided design
Conducting in-depth research on industry-related topics in order to develop original content. Developing content for blogs, articles, product descriptions, social media, and the company website. Ass...
content managementeditingseowritingweb site productioncontent writingmicrosoft officekeyword researchinterior designingproduct descriptionseffective communicationresearcharticlesmarketingpolishingportfolioJob Description South Indian Chef Job Summary We are looking for a chef to join our team and prepare lip-smacking dishes for our customers. The primary responsibilities include studying recipes, s...
deliverymanagement skillskitchenbakingequipmentcookingtime managementcommunication skillscutlerycompliancemanagementleadershipfoodtakes direction wellsaltleadership skillspastatake ordersJob Location : PuneSetup (Locations): Austin, TX / Chico, CA / London, UK /Head count: 150+ Job Brief: Engineering Manager Compan...
computer sciencedocumentationproduct managementpreventive maintenancecommissioningsafetysql servercontinuous improvementdata scienceproduct developmentagile developmentisodesign thinkingJob Location : Pune Setup (Locations): Austin, TX / Chico, CA / London, UK / Job Brief: QA Engineer Should have Minimum 3+ years...
front endtest casestesting toolsquality testingtestingmailautomationinspectiontest scenariosregression testingsecurity testingresumesoftwaresecurityplanningautomated testingengineersqualityStweard/Stweardess The applicant should be confident, have good communication skills and be fluent in English. Since we are a dog friendly cafe, they must also be comfortable around dogs. - 1) Gree...
communication skillsfoodcafecommunicationMenu DevelopmentFine DiningBanquet OperationsRecipe DevelopmentMenu CostingMenu EngineeringCateringGourmetNew Restaurant OpeningsCafeteriaRoastingJD for Senior Telecom Testing Engineer In this position, will provide opportunity to work on validating 4G/5G packet core solutions in a cloud native environment with Control, User Plan separation. ...
iso 27001quality controlproduct supporttest systemsbug trackingiso 17025telecom testingcyber securitydefect trackingcore networktest casesJob Description for PHP Software Engineer : We are looking for a PHP Developer with 4 to 6 Years of PHP Object-Oriented Development Experience. He/She will be responsible for managing back-end servic...
mysqljavascriptjqueryajaxphpfront endweb serveruser storiessoftware qualitysecurity compliancesqlyelphtml5agilebasicsmartybackendoutlookmanualssoftwarereporting to Finance Head at Admin Office City: chennai State: chennai PostalCode: 600001 Notice Period: 30 Days Recru...
comfinancetallytally erptally erp 9epfwingserpstatutorytax deducted at sourcedirect taxaccounting standardstdsexcelwordfactbrsesiSalary: 8,000.00 to 50,000.00 /month Job Summary We are hiring both Senior and Freshers to work with them on the role of ASP.net Core MVC Developer. We are offshore ...
fixed income derivativesms sqloffshore software developmentchange managementdatabase administrationnetcognos impromptudata managementaspnet mvcWe are looking for a Java Developer with 4-8 years of experience whose role will be of an individual contributor. Requirements: Hands on strong experience with Core Java and Springs MVC. Fair knowl...
shell scriptingmanagement systemsspringsql databaseweb serviceshibernatejspcore javadatabase managementjavamysqljava web servicesLiaises with key company employees to determine their product and service needs Monitors business trends and product availability to pay the best price for company goods and services without sacrific...
working experiencecontinuous improvement facilitationlogisticsnegotiationpurchaseprocurementinventory managementsupply chainWe are looking to hire an experienced project to oversee the design and execution of construction projects for our clients. With each project, you will be meeting with clients and stakeholders to disc...
project managementsitecustomer relationstenderbuildingsms officefinal inspectionarchitectural designcommercial buildingsconstruction projectscarerevitlistsretaildesignautocadsoftwaredraftingshoppingJob Opening : Oracle APPs Developer Experience : 3 -5 Year(s) Keywords / Skills: Oracle E-Business Suite, PL/SQL, Oracle EBS Education : B.E/B.Tech, MCA, M.E/M.Tech Role : Software Engineer/ Programm...
strong analytical skillsoracle appsoracle formsbi publisheroa frameworkexplain planxml publisherdata migrationanalytical skillsoracle ebusiness suite
Senior Frontend (React) Engineer @Pune, India. Position Responsibilities:
We are looking for a Java Developer with 4-8 years of experience whose role will be of an individual contributor. Requirements: Hands on strong experience with Core Java and Springs MVC. Fair knowl...
shell scriptingmanagement systemsspringsql databaseweb serviceshibernatejspcore javadatabase managementjavamysqljava web servicesMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
shell scriptingjavajenkinssvnautomationstrong communication skillssap basissap financesupply chainbook reviewschange controlbuild projectsproblem solvingsap applicationautomation toolsrelease managementMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
test datasap financesupply chaintest coveragetest processesdata managementtest automationsoftware qualityMaersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
test datasap financesupply chaintest coveragetest processesdata managementtest automationsoftware qualitysoftware analysisproject managementPosition: Pricing Executive / Manager Office Location: Nehru Place, New Delhi Requirement: Exp: 3 to 5 years CTC: We would be able to pay not beyond INR 5 Lacs per annum.
Maersk is going through times of unprecedented change. From the farm to your refrigerator, or the factory to your wardrobe, we are developing solutions that meet customer needs from one end of the sup...
it budgetingsap ficosap mmproblem solvingsap projectsinvoice processingtechnology architecturesapcareer developmentptppayfinancial justificationtravel managementsupply chainPHP WordPress Expert - Minimum 2 years relevant Experience. Graduate (B.Tech preferred but not Mandatory). Location Kolkata (South).
Maersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solvingFull-stack PHP Developer. Candidate should have 5+ years experience minimum. Nice to haves would be React experience and/or experience with Symfony or similar PHP frameworks. Responsibilities<...
mysqlphpjqueryjavascripthtmlfront endweb serverscomputer sciencemobile applicationsxmlcssjavanicedesignmobilebackenddesktopMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solvingMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
sap financeproblem solvingmaster dataself servicesap eccsap solutionsbusiness unitsrisk managementmaterial masterscrum masterproduct visioncustomer self serviceMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solvingAs an SAP BRIM RAR expert, you will lead engagement with Order-To-Cash (OTC), Accounting-To-Reporting (ATR) and Revenue Accounting teams for assigned finance platform, partner with finance technology ...
automationcustomer relationsdata modelingend to end solutionssap financeit budgetingjavauser storiessap solutionslinuxdata managementMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solvingMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solvingMaersk is going through times of unprecedented transformation. From the farm to your refrigerator, or the factory to your wardrobe, we are developing path-breaking solutions that meet customer needs s...
deliveryadobe streamlineassets recoverybusiness processbusiness requirementsend to end solutionssap eccsap ficosap financemaster datauser storiessap solutionsgeneral ledgerproduct visionproblem solving© 2019 Hireejobs All Rights Reserved