| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
| Ajax Jobs |
| Designing Jobs |
| ASP .NET Jobs |
| Java Jobs |
| MySQL Jobs |
| Sap hr Jobs |
| Software Testing Jobs |
| Html Jobs |
| Job Location | Vadodara |
| Education | Not Mentioned |
| Salary | Not Disclosed |
| Industry | IT - Software |
| Functional Area | Customer Service (International)General / Other Software |
| EmploymentType | Full-time |
Superior communication skills with the ability to communicate a vision with persuasiveness and passion. Ability to listen and incorporate the views and opinions of others with judgement. A flexible and adaptable approach to work. A full understanding & regular use of all technical aspects of your role. Swift and Strong client and team interaction. Deliver the highest quality of work that is accurate and on time. To actively organize and participate in all the activities of the office. Accuracy and attention to details. Required Knowledge and skills Strong analytical and problem solving skills. Screening telephone calls, enquiries and requests and handling them. Provide support to team internally and client. Manage day to day errands of the office. Mail server configurations - IIS - DNS - DHCP Understand the organisational issues and have good understanding of businesss aims and objectives Process and Team working Ensure effective communication with the Techsupport team. To understand the overview of the technical side of the project. To actively participate in the team meetings to exchange information and ideas. Attention to detail with good level of accuracy. Demonstrate a basic level of initiative and resourcefulness. Key Responsibilities Customer Service To be approachable at all times. Customer guidance with reference to online renewals and payments. Assist in the successful delivery of client solutions, client support and systems implementations. Enhance and maintain existing clientele hosting data. Understand the marketing objective for each client and deliver above marked expectations. To adhere to the timeframes of domain and hosting renewals. Attention to detail with good level of accuracy. ,
Keyskills :
marketingbasicexchangemaildhcpswiftiisscreeningdnsnquiriesbusinessrenewalslistenerrandspayments