Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Chandigarh |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | Recruitment Services |
Functional Area | Sales / BDGeneral / Other Software |
EmploymentType | Full-time |
liaising with clients and developing animation from their concepts; creating storyboards that depict the script and narrative; drawing in 2D to create sketches, artwork or illustrations; designing models, backgrounds, sets, characters, objects and the animation environment; using a range of materials, including modelling clay, plaster, oil paints, watercolours and acrylics; developing the timing and pace of the movements of a character or object during the sequence of images (called the animatic) and ensuring they follow the soundtrack and audio requirements; using technical software packages, such as Flash, 3d studio max, Maya, Lightwave, Softimage and Cinema 4D; building up accurate, detailed frame-by-frame visuals; recording dialogue and working with editors to composite the various layers of animation (backgrounds, special effects, characters and graphics) in order to produce the finished piece; working to production deadlines and meeting clients commercial requirements; teamworking as part of a broader production network, which might include liaising with printers, copywriters, photographers, designers, account executives, website designers or marketing specialists; dealing with diverse business cultures, delivering presentations and finding funding. Much of the work involves pitching and being proactive in selling your ideas and work to prospective customers and clients. This applies across the board, whether you are self-employed, working freelance or employed within a business. ,
Keyskills :
3dstudiomaxsoftwarepackagesmayaflashsellingdrawinginema4dclientmeetingspecialeffectsaccountexecutivesmaxclaypaintcinematimingartwplasterobjects