| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Hyderabad Jobs |
| Banglore Jobs |
| Chennai Jobs |
| Delhi Jobs |
| Ahmedabad Jobs |
| Mumbai Jobs |
| Pune Jobs |
| Vijayawada Jobs |
| Gurgaon Jobs |
| Noida Jobs |
| Oil & Gas Jobs |
| Banking Jobs |
| Construction Jobs |
| Top Management Jobs |
| IT - Software Jobs |
| Medical Healthcare Jobs |
| Purchase / Logistics Jobs |
| Sales |
| Ajax Jobs |
| Designing Jobs |
| ASP .NET Jobs |
| Java Jobs |
| MySQL Jobs |
| Sap hr Jobs |
| Software Testing Jobs |
| Html Jobs |
| Job Location | Kolkata |
| Education | Not Mentioned |
| Salary | Not Disclosed |
| Industry | Recruitment Services |
| Functional Area | General / Other Software |
| EmploymentType | Full-time |
To qualify for the role you must have A Bachelors in Computer Science or a related field and 8 years or more of related work experience; or a Masters degree in Computer Science or a related field and 6 years or more of related work experience Experience in enterprise level software development 6+ years of experience in .NET full life cycle software development using latest .NET stack of technologies Good knowledge in object oriented and other design principles Expert level knowledge and experience in technologies/tools such as C#.NET, ASP.NET MVC, ASP.NET, WCF Web Services, ORM framework, Entity Framework, ADO.NET, Visual Studio, TFS/GIT, Angular JS, AJAX, jQuery, MS SQL Server, T-SQL, XML, JSON Expert level knowledge and experience in the design and development of databases (specially SQL Server) is must Experience with Azure and Azure development is preferred Experience in deployment automation on TFS Ideally, youll also have Experience in SSIS, SSAS, Share point, Tableau, Power BI and other relational databases is a plus Experience in big data, visualization methods and processes, and analytics skills Experience in project planning and team coordination Experience in US tax domain a plus Ability to work with clients both individually as well as in a highly collaborative and fast paced environment Interest in learning new technologies Excellent communication and interpersonal skills ,
Keyskills :
sqlservernetjqueryjavascripthtmlmssqlwebservicesvisualstudiocomputerscienceprojectplanningsoftwaredevelopmentssqlserverustaxbigdatapowerbilifecycleaspnetmvcentityframew