hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Analyst and Sr Analyst

1.00 to 3.00 Years   Mumbai City   25 Jun, 2019
Job LocationMumbai City
EducationNot Mentioned
SalaryNot Disclosed
IndustryRecruitment Services
Functional AreaSales / BD
EmploymentTypeFull-time

Job Description

Skills Problem Solving Business Skills SAS, SPSS Predictive Modeling Statistical Forecasting Models Behavioral Analytics Marketing Analytics Correlation & Regression Models Strong communication skills Domain BSFI (Banking Securities and Financial Services Industry) Retail KPO ITES / BPO Market research FMCG Pharmaceutical Credit cards or risk projects analytics Roles and Responsibility Manipulate large data sets Hypotheses testing Regression and correlation analysis Execute on project and analysis plans under the guidance of Project Manager. Interact with consultants/ clients to formalize data sources, understand data, acquire relevant business knowledge Validate analysis & process Conduct analysis and develop recommendations Contribute to knowledge and firm building activities ,

Keyskills :
marketresearchproblemsolvingfinancialservicesmarketinganalyticscommunicationskillstrongcommunicationskillscommercialmodelsregressionmodelsbusinessknowledgepredictivemodelingtfoliomarketing

Analyst and Sr Analyst Related Jobs

© 2019 Hireejobs All Rights Reserved