Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
We are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyPosition Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearch commercialmodels regressionmodels financialservices businessknowledge predictivemodeling marketinganalytics bpo kpo sas ites spss tfoliomarketing relationanalysis behavi alanalyticsWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyResponsibilities The candidate is expected to collaborate with Equifax- Atlanta to provide high end analytical solution in order to develop the best in industry products. Work on diverse generic r...
msoffice dataquality dataanalytics retailbanking dataassessment projectexecution linearregression modeldevelopment regressionmodels developmentdesign productdevelopment kingwithclients statistical
Job Description Prepare a comprehensive industry research reports on several verticals Work on all/ any aspect of research : research planning, primary research, secondary research Create multi-...
research validation hplc documentation calibration writingskills primaryresearch industryresearch researchplanning regressionmodels secondaryresearch it spss excel ep twriting relationanalysis writin
Job Description Prepare comprehensive industry research reports on several verticals Work on all/ any aspect of research : research planning, primary research, secondary research, quality checking...
sales marketing writing excel research orrelationanalysis regressionmodels marketresearch researchplanning writingskills reportwritingPosition Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearch commercialmodels regressionmodels financialservices businessknowledge predictivemodeling marketinganalytics bpo kpo sas ites spss tfoliomarketing relationanalysis behavi alanalyticsWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagement customerrelations functional marketing documentation dataanalysis productanalysis regressionmodels productdevelopment keffectivelyPosition Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearch commercialmodels regressionmodels financialservices businessknowledge predictivemodeling marketinganalytics bpo kpo sas ites spss tfoliomarketing relationanalysis behavi alanalytics- Influence and support through expert internal and external research and analysis, our product decisions, and product launches - Use expertise in quantitative analysis, data mining and data presenta...
sql dataanalysis microsoftexcel customerrelations datamining customercare advancedexcel onlinecontent googleanalytics regressionmodels datapresentation productmanagement productdevelopment ep tingBuild automated test suites using opensource tools and build custom testing tools using python as required. Design and implement automated tests and test plans covering functional, performance, scal...
jenkins linux automation git maven estsuites testingtools apachespark driveresults datastructures computerscience regressionmodels linearregression opensource testcases systemsoftwarePrepare a comprehensive industry research reports on several verticals Work on all/ any aspect of research : research planning, primary research, secondary research Create multi- factor regression m...
research validation hplc documentation calibration writingskills primaryresearch industryresearch researchplanning regressionmodels it spss excel writing planning analysis ep twriting relationanalysisThe Executive will be responsible for interpreting briefs in conjunction with client servicing teams, designing the analytical approach and then executing projects; particularly in the field of distri...
businessgrowth clientservicing exceldashboards clientmanagement managementskills regressionmodels negotiationskills sas his excel basic anova briefs testing running business analytics servicing management nalyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagementcustomerrelationsfunctionalmarketingdocumentationdataanalysisproductanalysisregressionmodelsproductdevelopmentkeffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagementcustomerrelationsfunctionalmarketingdocumentationdataanalysisproductanalysisregressionmodelsproductdevelopmentkeffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagementcustomerrelationsfunctionalmarketingdocumentationdataanalysisproductanalysisregressionmodelsproductdevelopmentkeffectivelyWe are looking for Product Analysts who can jump in and make an impact quickly. Product Analysts can expect to set up and analyze A/ B tests for new experimental features, generate and size opportunit...
productmanagementcustomerrelationsfunctionalmarketingdocumentationdataanalysisproductanalysisregressionmodelsproductdevelopmentkeffectively- Influence and support through expert internal and external research and analysis, our product decisions, and product launches - Use expertise in quantitative analysis, data mining and data presenta...
sqldataanalysismicrosoftexcelcustomerrelationsdataminingcustomercareadvancedexcelonlinecontentgoogleanalyticsregressionmodelsdatapresentationproductmanagementproductdevelopmenttingPosition Analyst and Sr Analyst Relevant experience Qualification Skills Domain Roles and Responsibility 0- 4 yearsB.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s)Problem S...
marketresearchcommercialmodelsregressionmodelsfinancialservicesbusinessknowledgepredictivemodelingmarketinganalyticsbpokposasitesspsstfoliomarketingrelationanalysisbehavialanalyticsSkills Problem Solving Business Skills SAS, SPSS Predictive Modeling Statistical Forecasting Models Behavioral Analytics Marketing Analytics Correlation & Regression Models Strong communication skills...
marketresearchproblemsolvingfinancialservicesmarketinganalyticscommunicationskillstrongcommunicationskillscommercialmodelsregressionmodelsbusinessknowledgepredictivemodelingtfoliomarketingPosition Analyst and Sr Analyst Relevant experience 0- 4 years Qualification B.Tech./ B.E./ Masters Degree/ M.Phil./ MBA from reputed institute(s) Skills Problem Solving Business Skills SAS, SPSS Pred...
marketresearchproblemsolvingfinancialservicesmarketinganalyticscommunicationskillstrongcommunicationskillscommercialmodelsregressionmodelsbusinessknowledgepredictivemodelingtfoliomarketing© 2019 Hireejobs All Rights Reserved