hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Rave Programmer Pharma/life Sciences Mumbai/bangalore/pune (1+years

1.00 to 6.00 Years   Mumbai City   17 Jun, 2019
Crescendo Group International
Job LocationMumbai City
EducationNot Mentioned
SalaryRs 4.0 - 9 Lakh/Yr
IndustryRecruitment Services
Functional AreaSales / BDGeneral / Other Software
EmploymentTypeFull-time

Job Description

A job opportunity for a professional holding at least 1 year of experience in Life sciences and Pharma domain. You must have expertise in core rave programming of data using medidata tools, exposure in edit check programming and building DB and ecrf. You must have proficiency ion report programming, CF programming, vendor data integration, coding setups etc. You must have experience working using various custom functions and J review tool. If this sounds exciting, go ahead and apply! Location: Mumbai/ Pune/ Bangalore Your Employer: A leading, global firm providing creative and strategic analytics, IT and consulting solutions for the entire enterprise value chain. Responsibilities:

  • To hold an expertise in Clinical Data Management and programming concepts.
  • To do quality control for database designs and programming.
  • To have a good understanding of regulatory requirements and guidelines
  • To assist in development and implementation of new technology in database designing.
  • To create data management techniques.
  • To provide technical expertise to the clinical data management team.
Requirements:
  • At least 1 year of experience in Core rave programming. Expertise using Medidata tools like iMedidata.
  • DB and ecrf build experience
  • Edit check programming experience
  • External data listings and SAS checks created
  • Report programming done
  • Experience of CF programming vendor data integration Coding setup and Migration
  • Worked on different type of Custom function and used the J review tool
Whats in the store for you
  • Opportunity to work with fast paced organization.
  • Fast track career growth.
Reach us If you think this role will add value to your career, kindly write me an email along with your updated CV on poojabansal@crescendogroup.in for a confidential discussion on the role. ,

Keyskills :
sasiondivecrfemailreachpharmavendcheckscontroldatabase

APPLY NOW

Rave Programmer Pharma/life Sciences Mumbai/bangalore/pune (1+years Related Jobs

© 2019 Hireejobs All Rights Reserved