Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Receiving the problematic cards from the site and maintaining records Performing the activities of Soldering, Trouble shooting, Components replacement to let them work Suggesting the replacement of th...
documentation inspection aerospace materialsmanagement quality mis cards es design usicmaking finalquality testrep ting designspecifications qadocumentation qa bsc pcb tests st vendchecksReceiving the problematic cards from the site and maintaining records Performing the activities of Soldering, Trouble shooting, Components replacement to let them work Suggesting the replacement of th...
documentation inspection aerospace materialsmanagement quality mis cards es design usicmaking finalquality testrep ting designspecifications qadocumentation qa bsc pcb tests st vendchecks1. Need to work in leather goods & accessories Department. 2. Needs to bear the responsibility of merchandiser. 3. Needs to work on ERP software. 4. Needs to do the follow-up with vendor and produc...
retail merchandising hindi english sourcing erp design fashion ontinuousimprovementfacilitation fashionshows designdrawings shoes vendchecks leather footwear conducting access ies developments ContinuousImprovementReceiving the problematic cards from the site and maintaining records Performing the activities of Soldering, Trouble shooting, Components replacement to let them work Suggesting the replacement of th...
documentation inspection aerospace materialsmanagement quality mis cards es design usicmaking finalquality testrep ting designspecifications qadocumentation qa bsc pcb tests st vendchecksReceiving the problematic cards from the site and maintaining records Performing the activities of Soldering, Trouble shooting, Components replacement to let them work Suggesting the replacement of th...
documentation inspection aerospace materialsmanagement quality mis cards es design usicmaking finalquality testrep ting designspecifications qadocumentation qa bsc pcb tests st vendchecksACCOUNT PAYABLE , COST CONTROL , , CONSTRUCTION SITE , VENDOR MANAGEMENT , AP , MIS Salary (Per Annum) 3 , 00 , 000 4 , 25 , 000 Work Experience 3 Year 8 Year Job Requirements To handle entire payab...
costcontrol management industrialconstruction ap mis french vetting management construction FIDIC CostPlanning end constructionsite care salary vendchecks control business CostEngineering CostRep ting1. Need to work in leather goods & accessories Department. 2. Needs to bear the responsibility of merchandiser. 3. Needs to work on ERP software. 4. Needs to do the follow-up with vendor and produc...
retailmerchandisinghindienglishsourcingerpdesignfashionontinuousimprovementfacilitationfashionshowsdesigndrawingsshoesvendchecksleatherfootwearconductingaccessiesdevelopmentsContinuousImprovementExperience in running the health checks and capacity checks Experience in performing the restorations. Should have experience in managing the s/ w and h/ w vendor calls Knowledge on evault replicat...
nfscifsbasicwintelmanagementmaintenanceinstallationavamarvendcheckscontrolrunningdatadomainreplicationACCOUNT PAYABLE , COST CONTROL , , CONSTRUCTION SITE , VENDOR MANAGEMENT , AP , MIS Salary (Per Annum) 3 , 00 , 000 4 , 25 , 000 Work Experience 3 Year 8 Year Job Requirements To handle entire payab...
costcontrolmanagementindustrialconstructionmisfrenchvettingmanagementconstructionFIDICCostPlanningendconstructionsitecaresalaryvendcheckscontrolbusinessCostEngineeringCostReptingResponsible for the equipment s operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and availability. Ensure efficient a...
noctclsocqosslakpislasroutingsecurityatmsvendchecksbusinessResponsible for the equipment s operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and availability. Ensure efficient a...
noctclsocqosslakpislasroutingsecurityatmsvendchecksbusinessExperience in running the health checks and capacity checks Experience in performing the restorations. Should have experience in managing the s/ w and h/ w vendor calls Knowledge on evault replicat...
nfscifsbasicwintelmanagementmaintenanceinstallationavamarvendcheckscontrolrunningdatadomainreplicationA job opportunity for a professional holding at least 1 year of experience in Life sciences and Pharma domain. You must have expertise in core rave programming of data using medidata tools, exposure i...
sasiondivecrfemailreachpharmavendcheckscontroldatabaseJOB PURPOSE To ensure the business meets procurement needs by ensuring prompt creation of Purchase Orders, business support in the requisition process and availability of catalogues. KEY RE...
scmslagfsriskcosmostestingvendcheckspromptJOB PURPOSE To ensure the business meets procurement needs by ensuring prompt creation of Purchase Orders, business support in the requisition process and availability of catalogues. KEY RE...
scmcoeslagfsriskcosmosturnbrandvendcheckspromptResponsible for the equipment s operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and availability. Ensure efficient a...
noctclsocqosslakpislasroutingsecurityatmsvendchecksbusinessResponsible for the equipment s operation and maintenance (Fault, configuration, alarm, performance and security) or network components to drive network efficiency and availability. Ensure efficient a...
noctclsocqosslakpislasroutingsecurityatmsvendchecksbusiness© 2019 Hireejobs All Rights Reserved