adhoc reports jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

adhoc reports Job Openings

Showing 32601 - 32650 of 34641 Jobs

Internal Auditor

MULTI RECRUITERS 0.00 to 2.00 Years Kochi 12 Oct, 2023

Internal Auditor will be responsible for planning, assigning, and supervising the daily tasks given to other auditors in the organization.

Audit Manager will help to tra...
audit managementstatutory auditexternal reportingaudit reportstax auditsinternal auditaudit professionalsaudit compliance

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Kochi 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

Branch Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 4.00 to 9.00 Years Kanpur 12 Oct, 2023

Job Role

To increase customer profitability through effective cross sales and up sellframework.

Continuous Process refinement for enhanced marketing ROI branch salesdirect sales

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Project Manager (Construction Services)
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi...
flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.

Manager, Construction Management, Self Perform
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Accountant ( Infrastructure )
PRO APEX INFRA LLP 3.00 to 6.00 Years Hyderabad 12 Oct, 2023

Role: Accountant ( Infrastructure ) Experience needed: 3 - 6 years Department: Infrastructure Constructions & Site Engineering Educat...
ms officegstconstructiontallybook keepingaccounting

Spotfire Admin
Quess Corp (Magna Infotech) 3.00 to 8.00 Years Hyderabad 12 Oct, 2023

Spotfire Admin Exp- 3 to 8 yrs Location - Andhra Pradesh,Haryana,Karnataka,Maharashtra,Tamil Nadu,West Bengal Hyderabad,Gurgaon,Bangalore,Mumbai,Pune,Chennai Np- 15days to immediate Technical...
spotfire.netjavaironpython

Territory Business Manager - Hyderabad - Victora
Abbott Healthcare 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

MAIN PURPOSE OF ROLE Summarize the main purpose of the role. Conduct market research and feasibility studies to analyze the viability of alternative busi...
salesmarketingbusiness developmenttargetretailbase paymarket researchsenior managementfeasibility studiespayresearchbusinessstrategymaterialsviabilitymanagementoperationspresentationsPricing

SLP Coordinator, SLP Cluster - West 5
Amazon 3.00 to 5.00 Years Gurugram 12 Oct, 2023

The primary objective of the Security & Loss Prevention coordinator is to ensure the protection of people & assets of Amazon s FC in accordance with global Security guidelines and Policies The rol...
control roomnew projectsprocess reviewloss preventionlaw enforcementasset protectioncorrective actionprocess improvementbehavioral traininginformation securitypreventive maintenancesecurity investigationsamccareslascapa

Asst Manager - Private Equity Fund Accountin
NTT Global Delivery Services Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Roles and Responsibilities

Review Booking Journal Entries basis bank statements and client

Review of Bank Reconciliation and maintaining the respectiv...
cash flowhedge fundsprivate equityjournal entriesbank statementsfinancial reportingbank reconciliationfinancial justificationcashcapitalbespokeexpensesreportingportfoliomanagementmonitoringmaintenanceperformanceliabilities

Sales Manager
Williams Consulting Pvt Ltd 2.00 to 4.00 Years Gurugram 12 Oct, 2023

Skills required:

Excellent written and spoken English with complete clarity in diction and

Motivated to learn, share and apply sales processes and<...
senior salesbusiness development

Store Manager
Garima Interprises Hiring For Garima Interprises 1.00 to 6.00 Years Gurugram 12 Oct, 2023

A store manager is responsible for overseeing the daily operations of a store, making sure it runs smoothly and effectively. Their duties include motivating sales teams, creating business strateg...
customer servicecommunication skillsproblem solvingdecision-makingretail

Banca Channel
Times Consultancy Services 1.00 to 4.00 Years Delhi 12 Oct, 2023

Vacancy for Banca Channel (South Indian Bank) in Max life Insurance Company Limited. Position: Banca Channel Direct Reports: Business Manager / Area Manager Function / Department: Banca CTC :...
communication skillssales

Account Executive
Cocentrus Hiring For Delhi 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring for Account Executive Profile for East Delhi IP Extension location. Please find the details as below :- Job Profile :Account Executive ...
gsttdstally erpbookkeepingaccount executives

Hiring for Authorizer for Leading Bank at Delhi-Mukherjee Nagar & Mansarovar
V-Konnect Associates Hiring For Hiring for Authorizer for Leading Bank at Delhi-Mukherjee Nagar & Mansarovar 3.00 to 8.00 Years Delhi 12 Oct, 2023

Jole Role- Cash Management & Operations: Responsible for efficiently managing the cash operations (receipt & payment) across the counter including ATM replenis...
customer servicepersonal bankingcash handlingbranch operationsbanking operationsteller operations

Home Loan Sales officer
HR Desire 0.00 to 2.00 Years Gurugram 12 Oct, 2023

We have opening for Home Loan Sales officer, kindly find the job details below: Mandatory to fill: Tracker

Post Applied for
salesloans

back Office Assistant
Synergy Plus Business Consulting Group Hiring For school 1.00 to 5.00 Years Gurugram 12 Oct, 2023

Greetings Everyone - BACK DESK ASSISTANT(FENALE ) is required for a Renowned School for GURGAON location Interested candidates can apply - hidden_email( backend operationsback officeback office operationsdata entry

HIRING Store Manager-Noida
Shree Balaji Enterprises 0.00 to 1.00 Years Noida 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
store managementordering

HIRING Store Manager-Faridabad
Shree Balaji Enterprises 0.00 to 1.00 Years Faridabad 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
salesstore management

HIRING Store manager-Ghaziabad
Shree Balaji Enterprises 0.00 to 1.00 Years Ghaziabad 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
store managementsales

HIRING Store manager-Delhi
Shree Balaji Enterprises 0.00 to 1.00 Years Delhi 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
salesstore management

Autocad Draftsman
Ikamate HR India Pvt Ltd 2.00 to 7.00 Years Gurugram 12 Oct, 2023

Job Title: AutoCAD Draftsman Location: Vithalapur Office/PAN India Salary: Depends upon experience and skills Qualification: Diploma in Civil Engineering/ITI in Civil Engineering from reputed ...
cadautocad

Finance Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Gurugram 12 Oct, 2023

Finance managers are business specialists who manage important financial functions of an organization. They produce financial reports, manage investment activities, and create strategies and plan...
organizationproblem solvingdecision-makingmathematicscommunication skills

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Urgent hiring for Sales Executive
M/S ALL INDIA MARKETING AND HR SOLUTION Hiring For M/S ALL INDIA MARKETING AND HR SOLUTION 0.00 to 1.00 Years Gurugram 12 Oct, 2023

JOB DESCRIPTION OF SALES EXECUTIVES Roles and Responsibilities Developing franchisee partners and expand the business. - Identify the potent...
telecallingcold callingsalessales coordination

Hospitality Manager
NATIONAL SEEDS CORPORATION LIMITED 10.00 to 20.00 Years Gurugram 12 Oct, 2023

We are looking to hire a dynamic hospitality manager to join our company. In this role, your duties will include coordinating daily hospitality activities and operations, supervising staff member...
manager of managersguest service managementmanagementglobal tactical asset allocationproperty management systemshospitality managementasset allocationglobal asset managementglobal investment managementmanagerial

STORE MANAGER DELHI
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Delhi 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Data Entry Operator
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Skills: Basic Computer Knowledge Description We are looking for freelancers that can do simple data entry to spreadsheet and send email to the compa...
data analysisdata entry

Accountant
S P Jagannath & Sons Hiring For Accountant 5.00 to 8.00 Years Delhi 12 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
balance sheet finalisationtaxationaccountingaccounts finalisationbank reconciliationbranch accountingtaxgoods

US Accountant
Eveneum Solutions Private Limited 3.00 to 6.00 Years Delhi 12 Oct, 2023

Summary: We are looking for a highly motivated and experienced Bookkeeper/Accountant. The ideal candidate will have a strong understanding of US bookkeeping and accounting. asanaaccountingquickbooksexceladp payrollgood communication

Salesforce Developer with Aura
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd, India we are hiring for the below job positions. Work Location : Chennai/Hyderabad/Bengaluru/Pune/Noida Exp: 5 Yrs Skill : Salesforce Developers ...
salesforcelightingwebforce.comsfdclightningauralwc

Software Test Engineer _Remote
MNR Solutions Pvt Ltd 3.00 to 5.00 Years Delhi 12 Oct, 2023

Software Test Engineer Responsibilities Meeting with development managers to discuss software specifications and controls. Using the software as intended...
testingsoftware engineering

Software Test Engineer _Remote
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Meeting with development managers to discuss software specifications and controls.

Using the software as intended to analyze its functional properties.

De...
software engineeringtesting

Store Manager Ghaziabad
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Ghaziabad 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

STORE MANAGER NOIDA
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Noida 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory planningstore operations

STORE MANAGER FARIDABAD
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Faridabad 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

Sales Coordinator
G H AND S RECRUITERS 1.00 to 3.00 Years Delhi 12 Oct, 2023

FEMALE CANDIDATES ONLY Position: Sales Coordinator (Female Candidates ONLY) No. of Positions: Two (2 Nos) Job Location: South Delhi (Okhla PH - II) Industry : Manufacturing (...
sales supportback officesales coordinationsales administrationoffice coordinationsales order processing

Sales Manager in a leading Packaging Company
Jobs Territory Hiring For Client is into Packaging company 4.00 to 9.00 Years Bangalore 12 Oct, 2023

Responsibilities

Achieve growth and hit sales targets by successfully managing the sales team

Design and implement a strategic business plan that expands companys customer ba...
field salesonboarding

District Manager - Medical Representative (Dermatology)
Talent Corner HR Services Pvt Ltd 2.00 to 7.00 Years Delhi 12 Oct, 2023

Position Summary: You will be responsible for driving business growth in assigned territory, maintaining effective customer relations, mapping territory potential, cascading scie...
medical salesdermatologysalesrepresentativemedical

Clinical Researcher
QUISCON BIOTECH 0.00 to 1.00 Years Delhi 12 Oct, 2023

We are looking for an organized, flexible Clinical Research Associate to oversee clinical trials. The Clinical Research Associate will develop and outline trial protocols, establish trial sites, ...
clinical research associatesclinical data managementclinical researchclinical trialsclinical monitoring

Executive Assistant
Vibgyor Enterprises Hiring For Personal assistant 3.00 to 8.00 Years Delhi 12 Oct, 2023

Dear Candidate, Urgent opening forPersonal or Executive Assistant, for our end client (working into Financial and Agriculture domain- Mnc company) Working Location: Gur...
travel managementcalendar managementexecutive assistantpersonal secretarymeetings booking

Regional Manager
NATIONAL SEEDS CORPORATION LIMITED 10.00 to 20.00 Years Delhi 12 Oct, 2023

We are looking for an experienced regional manager to oversee our business operations in an assigned region. The regional manager will be responsible for leading and managing daily operations to ...
negotiationbusiness developmentregional managementdaily operationsplanningsupervisiontrainingbudget management

Clinical Data Management
TECHNO ENDURA 0.00 to 1.00 Years Delhi 12 Oct, 2023

Clinical Data Management (CDM) Job Description Clinical Data Managers (CDMs) are responsible for ensuring the accuracy, integrity, and completeness of data collected in clinica...
clinical research associatesclinical monitoringclinical trialsclinical pharmacologyclinical data management

We have opening for Assistant Manager - Credit Cards
Bajaj Finserv Lending Ltd 1.00 to 2.00 Years Chandigarh 12 Oct, 2023

* Duties and Responsibilities - PRINCIPAL ACCOUNTABILITIES 1. Writing content for credit cards on various digital assets 2. Interacting with the marketing and the SEO team to update the current co...
salesmisaccountstatbankingcontent writingcustomer servicecustomer complaintscustomer experienceportfolio marketing

Required for safety officer in offshore platform
APEX OFFSHORE SERVICE 0.00 to 1.00 Years Chennai 12 Oct, 2023

GREETINGS We are looking for an fresher or experienced candidate with responsible Safety Officer to join. Safety Officer Duty & Responsibility...
ioshfire safetysafetyfire fightingdiplomaneboshfirebtechfire man

Business Development Professionals
Associated Recruitment & Management Services Pvt Ltd 15.00 to 25.00 Years Chennai 12 Oct, 2023

We have been engaged to locate Business Development professionals for the following positions by a leading and well established auto and industrial component organization with turnover of Rs.1,00...
apqpassemblieskamindustrialoemprecisionrfqcomponentauto

Looking for Desktop Support Engineer Chennai
Denova Hitech Solutions Pvt Ltd 1.00 to 6.00 Years Chennai 12 Oct, 2023

Desktop Support Engineer DL-1 Experience 0 to 2 years DL-2 Experience 2 to 5 years DL-3 Experience< 5yrs JD

Good Knowledge on WAN and LAN connectivit...
networkingrouterlan

Vmware Engineer
WaterMelon Management Services Pvt Ltd 4.00 to 9.00 Years Chennai 12 Oct, 2023

Requirement of VMware Engineer Job Location: Qatar Scope: VMware Resident Consultant will assist the Customer with the following activities as described: Assess to existing security rules Di...
vmwarevrni

PREV
NEXT

adhoc reports Job Openings

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi... flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ... delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.

Skills required:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi...
flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.

Construction Manager [Intro Paragraph] The best job descriptions take two or three sentences to introduce prospective construction managers to ...
delegation.industry knowledge.team management.risk management.communication.negotiation.flexibility.