Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
The Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiShipping Experience is Mandatory Post Graduate 6 years of experience in Domain Required Skills: Line or Agency part of the business Process specialist In-depth knowledge of transportation Inter...
insurance productdevelopment projectmanagement agency shipping MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements customersupp AdvertisinHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiUrgent hiring for the Aditya Birla Sun Life Insurance Company for the Agency Development Manager profile. Qualification- Graduation Designation- Agency Development manager profile. CTC- 2.15 lpa + ...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment behavioraltraining sun salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination igitaHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiShipping Experience is Mandatory Post Graduate 6 years of experience in Domain Required Skills: Line or Agency part of the business Process specialist In-depth knowledge of transportation Inter...
insurance productdevelopment projectmanagement agency shipping MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements customersupp AdvertisinThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiUrgent hiring for the Aditya Birla Sun Life Insurance Company for the Agency Development Manager profile. Qualification- Graduation Designation- Agency Development manager profile. CTC- 2.15 lpa + ...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment behavioraltraining sun salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination igitaWe are Hiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad, Bareilly. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment behavioraltraining max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsHiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad Age - 24-35 max Experience - Min.2 yr i...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiHiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad Age - 24-35 max Experience - Min.2 yr i...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiWe are Hiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad, Bareilly. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment behavioraltraining max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiDear Candidate, We are currently hiring for Agency Channel Manager position for Andhra Pradesh & Telangana Position: Agency Development Manager/Relationship Manager - Agency Channel,Direct Channel,B...
reach incentives max insurance matching gratuity sales salary resume marketing mail agency gencychannel agencyleadership lifeinsurance insuranceagencymanagement businessdevelopment agencyagreements behavioraltraining agencydevelopmentDear Candidate, We are currently hiring for Agency Channel Manager position for Andhra Pradesh & Telangana Position: Agency Development Manager/Relationship Manager - Agency Channel,Direct Channel,B...
agency hiring persistency sales addie rainingdelivery agencyagreements careerdevelopment agencychannel behavioraltraining digitalagency managingagencyrelationships trainingneedsanalysis agencyrelationshipmanagement insurancetraining agencylDear Candidate, We are currently hiring for Agency Channel Manager position for Andhra Pradesh & Telangana Position: Agency Development Manager/Relationship Manager - Agency Channel,Direct Channel,B...
matching max resume sales insurance reach agency marketing mail gratuity incentives salary nsuranceagencymanagement behavioraltraining agencyagreements agencydevelopment agencychannel agencyleadership businessdevelopment lifeinsuranceHiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad Age - 24-35 max Experience - Min.2 yr i...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiWe are Hiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad, Bareilly. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment behavioraltraining max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiHiring Associate Agency Development Manager(Agency Channel )for MNC Life Insurance company Qualificaton-Graduation Minimum 2 yrs of experiences required Age 24 to 35,...
insurance agency marketing persistency sales gencyleadership agencyagreements digitalagency lifeinsurance insuranceagencymanagement agencydevelopment insurancetraining agencycoordination businessdevelopmentCandidate should be from Life Insurance & Agency Experience of 4 to 5 years . He will recruit a team of Agency Partners and Agency Partners will recruit Insurance Agents and Advisors . Only Local cand...
sales businessdevelopment marketing customerrelations insurance lifeinsurance sun agency MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements dveHiring Associate Agency Development Manager(Agency Channel )for MNC Life Insurance company Qualificaton-Graduation Minimum 2 yrs of experiences required Age 24 to 35,...
insurance agency marketing persistency sales gencyleadership agencyagreements digitalagency lifeinsurance insuranceagencymanagement agencydevelopment insurancetraining agencycoordination businessdevelopmentHiring Associate Agency Development Manager(Agency Channel )for MNC Life Insurance company Qualificaton-Graduation Minimum 2 yrs of experiences required Age 24 to 35,...
insurance agency marketing persistency sales gencyleadership agencyagreements digitalagency lifeinsurance insuranceagencymanagement agencydevelopment insurancetraining agencycoordination businessdevelopmentZ2 Placement & Security Agency Pvt. Limited Job description Very Urgent opening for position of Nurse in Pata (Kanpur). Kindly send to me your resume for the post of Nurse. Should be ANM/ GNM or B...
gnm mmu agency resume security placement MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements AdvertisingCollateral gencyCo dination CertifiedProfShipping Experience is Mandatory Post Graduate 6 years of experience in Domain Required Skills: Line or Agency part of the business Process specialist In-depth knowledge of transportation Inter...
insuranceproductdevelopmentprojectmanagementagencyshippingMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencyAgencyLeadershipAgencyDevelopmentAgencyAgreementscustomersuppAdvertisinHi, Greetings from Willpower Consultants.! Designation -Agency Development Manager Salary package - 1.80 to3.75 Lpa Location : All Over India. Key Responsibilities: Agent Recruitment:- Develop v...
agencytargetmarketingimplementationpipeinsurancesalarybusinessgoldpersistencysalesdesignationnsuranceagencymanagementagencydevelopmentbehavioraltrainingagencyagreementsagencyleadershipdigitalagencybusinessdevelopmentagencycoordination
DEVELOPMENT OFFICER (TEAM LEADER) AS CAPTAIN OF A TEAM OF MINIMUM FIVE ADVISERS OR MORE. DEVELOP THE BUSINESS, RECRUIT NEW ADVISERS TO INCREASE TEAM SIZE, CUSTOMER SUPPORT, VISIT PROSPECTIVE CUSTOMERS...
salesrecruitmentinancialservicesmarketingagencycreativeagencyagencyleadershipagencycoordinationagencyagreementsagencydevelopmentDearCandidates Please note our Client Pro Healthcare Nursing Agency is looking for Indian Nurses in Qatar. About Pro-Health Care. They Provide Nurses to Hospitals & Poly Clinics. Package Work Hours:...
nursingbenefitsbasicoxygenagencyhospitalstransportationhealthcaresurgerygencycoordinationdigitalagencycreativeagencynursingeducationagencydevelopmentpatientcaremediaagenciesmarketingagencyagencyleadershipagencyagreementsadvertisingcollaExec / Sr. Exec - Health Agency Channel ( West ) Job Summary Agency Sales / Recruit agents / Generate Business Job Details Location Pune, Pune(10 Openings)+ 5 more Shift Timings 9:30 pm - 6:30 ...
agencydvertisingcollateralagencycoordinationcreativeagencymarketingagencyagencychannelagencyagreementsagencyleadershipdigitalagencymediaagenciesagencydevelopmentHi, We have urgent openings for Agency Development Manager& Managing Partner (company payroll) Experience- Min 7yrs exp. In Insurance CTC: Upto 6 LPA + Reimbursement + Incentives Location:Mumbai /...
performanceirdasetagencyincentivesconsultancyopeningsinsurancesalesforcesalesmarketingrecruitmentbusinessrecruitingusinessdevelopmentagencysalesagencyleadershipagencydevelopmentagencyagreementscustomerrelations
We are a home health agency with a census of ~120 patients and have a staff of 60 employees (FT and PT). When a patient is referred to our agency, one of our nurses evaluates the patient and decides t...
tecplotcomsolmpiumericalsimulationdigitalagencyvisitagencyschedulefluiddynamicsagencydevelopmentparaviewparallelcomputingcensusmarketingagencymediaagencieshighperformancecomputingagencyagreementsagencyleadershipopenmpcreativeagency© 2019 Hireejobs All Rights Reserved