Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Dear Candidate, We are currently hiring for Agency Channel Manager position for Andhra Pradesh & Telangana Position: Agency Development Manager/Relationship Manager - Agency Channel,Direct Channel,B...
matching max resume sales insurance reach agency marketing mail gratuity incentives salary nsuranceagencymanagement behavioraltraining agencyagreements agencydevelopment agencychannel agencyleadership businessdevelopment lifeinsuranceCandidate requirement:
Candidate requirement:
Candidate requirement:
Candidate requirement:
Candidate requirement:
Candidate requirement:
Candidate requirement:
Candidate requirement:
Hiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad Age - 24-35 max Experience - Min.2 yr i...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiWe are Hiring for MAX life insurance Designation- AADM (Associate agency development Manager) Location- lucknow, Varanasi, Moradabad, Kanpur, Gorakhpur, Allahabad, Bareilly. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment behavioraltraining max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiHiring for MAX life insurance Designation- Sales officer, Assosiate Agency Development Manager Location- Asansol, Barddhman, Bokaro, Dhanbad, Gaya, Kolkata, Patna, Rourkela. Age - 24-35 max Exper...
sales insurance recruitment marketing businessdevelopment agencydevelopment max salary agency AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency InsuranceTraining ersiThe Agency Development Manager is required to recruit Life Insurance agents or Life Insurance advisors and source business through them. The Agency Development Managers is also required to accompany a...
sales insurance lifeinsurance businessdevelopment marketing agencydevelopment salary agency business AgencyLeadership AgencyAgreements InsuranceAgencyManagement AgencyCoordination DigitalAgency nsuranceTrainiWe are looking Digital Marketing Executives to handle SEO / SEM / inbound Marketing Campaigns. We are an upcoming digital agency based out of Malad in the Western Suburbs of Mumbai. We are involved in...
marketing sales customerrelations businessdevelopment advertising digitalagency digitalmarketing inboundmarketing seo sem agency blogging MarketingAgency CreativeAgency AgencyLeadership dpress DigitalTrendAdministration Executives :: Chennai Capacity to handle various administrative functions Graduates with good communication skills Preferably with 2 years experience in a reputed ad agency,...
housekeeping microsoftoffice mis filing management communicationskills agency communication administration MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment endClient Service Executives :: Chennai Smart gogetters with a drive to achieve Graduates with good communication skills Preferably with 2 years experience in a reputed ad agency,...
advertising marketing sales businessdevelopment customerrelations communicationskills clientservice agency communication MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDeveAdd of more creativity and exhibiting the out let with amazing theme work as simple as possible. Vethics - Creative Digital Agency Add of more creativity and exhibiting the out let with amazing them...
mysql html css php digitalagency xml ajax html5 agency themes javascript woocommerce css3 MarketingAgency CreativeAgency AgencyLeadership DigitalTrends AgencyDevelopment dpress colURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopCandidate should be from Life Insurance & Agency Experience of 4 to 5 years . He will recruit a team of Agency Partners and Agency Partners will recruit Insurance Agents and Advisors . Only Local cand...
sales businessdevelopment marketing customerrelations insurance lifeinsurance sun agency MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements dveZ2 Placement & Security Agency Pvt. Limited Job description Very Urgent opening for position of Nurse in Pata (Kanpur). Kindly send to me your resume for the post of Nurse. Should be ANM/ GNM or B...
gnm mmu agency resume security placement MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements AdvertisingCollateral gencyCo dination CertifiedProfHe/She will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp & 100-200 Agents To meet the ye...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopHe/She will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp & 100-200 Agents To meet the ye...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopShipping Experience is Mandatory Post Graduate 6 years of experience in Domain Required Skills: Line or Agency part of the business Process specialist In-depth knowledge of transportation Inter...
insuranceproductdevelopmentprojectmanagementagencyshippingMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencyAgencyLeadershipAgencyDevelopmentAgencyAgreementscustomersuppAdvertisinLooking for an experienced business development manager who helps for growing sales and achieve target. The ideal candidate will have a digital agency background and proven experience in leading teams...
salesmarketingbusinessdevelopmentcustomerrelationstargetdigitalagencyidealagencybusinessMarketingAgencyCreativeAgencyAgencyLeadershipDigitalTrendsAgencyDevelopmentDigitalEngagementigitalChanHi, Greetings from Willpower Consultants.! Designation -Agency Development Manager Salary package - 1.80 to3.75 Lpa Location : All Over India. Key Responsibilities: Agent Recruitment:- Develop v...
agencytargetmarketingimplementationpipeinsurancesalarybusinessgoldpersistencysalesdesignationnsuranceagencymanagementagencydevelopmentbehavioraltrainingagencyagreementsagencyleadershipdigitalagencybusinessdevelopmentagencycoordinationDEVELOPMENT OFFICER (TEAM LEADER) AS CAPTAIN OF A TEAM OF MINIMUM FIVE ADVISERS OR MORE. DEVELOP THE BUSINESS, RECRUIT NEW ADVISERS TO INCREASE TEAM SIZE, CUSTOMER SUPPORT, VISIT PROSPECTIVE CUSTOMERS...
salesrecruitmentinancialservicesmarketingagencycreativeagencyagencyleadershipagencycoordinationagencyagreementsagencydevelopmentDearCandidates Please note our Client Pro Healthcare Nursing Agency is looking for Indian Nurses in Qatar. About Pro-Health Care. They Provide Nurses to Hospitals & Poly Clinics. Package Work Hours:...
nursingbenefitsbasicoxygenagencyhospitalstransportationhealthcaresurgerygencycoordinationdigitalagencycreativeagencynursingeducationagencydevelopmentpatientcaremediaagenciesmarketingagencyagencyleadershipagencyagreementsadvertisingcolla
- - - Exp. of minimum 2 years in advertising agency is must. - - - candidate should possess good visualization power and having great hand on Corel , Photoshop , Adobe illustrator.,...
advertisingadobephotoshopdesignbrochuresphotoshopadvertisingagencyadobeagencyvisualizationMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencyAgencyLeadershipAgencyDevelopmentAgencyAgr
Exec / Sr. Exec - Health Agency Channel ( West ) Job Summary Agency Sales / Recruit agents / Generate Business Job Details Location Pune, Pune(10 Openings)+ 5 more Shift Timings 9:30 pm - 6:30 ...
agencydvertisingcollateralagencycoordinationcreativeagencymarketingagencyagencychannelagencyagreementsagencyleadershipdigitalagencymediaagenciesagencydevelopmentGREETINGS FROM THE CAREER WINGS. We are having some immediate job openings with one of our leading MNC client. Company: Leading MNC LIFE/HEALTH insurance Companies Designation : Agency development ...
salesinsurancegencysalesagencyleadershiplifeinsurancechannelmarketingagencychannelfieldsalesb2csalesagencydevelopmentdirectsalesGREETINGS FROM THE CAREER WINGS. We are having some immediate job openings with one of our leading MNC client. Company: Leading MNC LIFE/HEALTH insurance Companies Designation : Agency development ...
salesinsurancegencysalesagencyleadershiplifeinsurancechannelmarketingagencychannelfieldsalesb2csalesagencydevelopmentdirectsalesHi, We have urgent openings for Agency Development Manager& Managing Partner (company payroll) Experience- Min 7yrs exp. In Insurance CTC: Upto 6 LPA + Reimbursement + Incentives Location:Mumbai /...
performanceirdasetagencyincentivesconsultancyopeningsinsurancesalesforcesalesmarketingrecruitmentbusinessrecruitingusinessdevelopmentagencysalesagencyleadershipagencydevelopmentagencyagreementscustomerrelationsGREETINGS FROM THE CAREER WINGS. We are having some immediate job openings with one of our leading MNC client. Company: Leading MNC LIFE/HEALTH insurance Companies Designation : Agency development ...
salesinsurancegencysalesagencyleadershiplifeinsurancechannelmarketingagencychannelfieldsalesb2csalesagencydevelopmentdirectsalesTeam lead in agency manager life insurance basic knowledge minimum 2 years above in life insurance agency development manager Knowledge of IRDA HNI HI LI CROSS SELL Supervise and recruit the Assi...
targetinsurancesalesmarketinghnibasicifeinsuranceagencycoordinationagencyleadershipdigitalagencyinsurancetrainingbusinessdevelopmentagencyinsuranceagencymanagementpersistencyagencydevelopmentTeam lead in agency manager life insurance basic knowledge minimum 2 years above in life insurance agency development manager Knowledge of IRDA HNI HI LI CROSS SELL Supervise and recruit the Assi...
targetinsurancesalesmarketinghnibasicifeinsuranceagencycoordinationagencyleadershipdigitalagencyinsurancetrainingbusinessdevelopmentagencyinsuranceagencymanagementpersistencyagencydevelopmentWe are a home health agency with a census of ~120 patients and have a staff of 60 employees (FT and PT). When a patient is referred to our agency, one of our nurses evaluates the patient and decides t...
tecplotcomsolmpiumericalsimulationdigitalagencyvisitagencyschedulefluiddynamicsagencydevelopmentparaviewparallelcomputingcensusmarketingagencymediaagencieshighperformancecomputingagencyagreementsagencyleadershipopenmpcreativeagency© 2019 Hireejobs All Rights Reserved