Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

data science techniques digital transformation engineering solutions technology services domain understanding Job Openings

Showing 5251 - 5300 of 153473 Jobs

Medical Coding Analyst

ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder

About Achievers Spot

medical lab technology

medical coding analyst

medical coding executive

Area Business Manager

RULOANS DISTRIBUTION SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Madurai, ErodeErode, Coimbatore, Chennai, Thirunelveli, Salem, Kanchipuram, Thiruvarur, Vilupuram, T 22 Jul, 2026

Field Officer Sales- Vehicle Loan

AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Madurai, ChennaiChennai, Ernakulam 22 Jul, 2026

Position: Field Officer Sales (FOS) Vehicle Loan

Department:

Interview Mode:

Working Days:

Retail Trainer

Ramraj Cotton 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Vellore, Tiruppur, Bangalore, Hyderaba 22 Jul, 2026

Job Summary:

Branch Manager-Agency | Life Insurance-Madurai

Lavya Associates HR Services Hiring For Leading Life Insurance Companies 1.00 to 10.00 Years Madurai, KottayamKottayam, Lakshadweep 22 Jul, 2026

We have an urgent openings for the position ofBranchManager in agency vertical in one of the leading Life Insurance Company

Territory Manager - Ag...
team handlingrecruitmentagencyadvisorvariable agency

Branch Manager-Direct | Life Insurance-Madurai

Lavya Associates HR Services Hiring For Leading Life Insurance Companies 1.00 to 10.00 Years Madurai, KottayamKottayam, Lakshadweep 22 Jul, 2026

We have an urgent openings for the position ofBranchManager in Direct vertical in one of the leading Life Insurance Company

BranchManager in direc...
life insurancedirect salessaless2sdsfleadsdirectpsf

Electrical Supervisor

AI MZ-Tech Consultant 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Chennai, Tirupati, Vijayawada, Hyderabad, Gurugram, Kolkata, Andam 22 Jul, 2026

Electrical Supervisor

electrical testing

electricals

electronics

electronics engineering

electroplating

electrical maintenance

electrical projects

electrical engineering

electronic security

Data Analytics Internship in Mumbai

Flipspaces 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Deputy Head Contracts & Procurement (Projects)

HR JOBS CONSULTANCY 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Jaipur, Chennai, Indore, Hyderabad, Gurugram, Vadodara, Ahmedabad 22 Jul, 2026

Deputy Head Contracts & Procurement (Projects)

Experience:

Industry Preference:

procurement contracts

procurement

procurement management

Architectural Draftsman

SHM ENTERPRISES 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Delhi 22 Jul, 2026

architectural animation

architectural drawings

architectural illustration

architectural modeling

architectural

Drilling Engineer

Future Solution Centre 1.00 to 10.00 Years Mumbai City, DehradunDehradun, Hyderabad, Pondicherry, Amritsar, Agartala, Asansol, Sikkim, Ajmer, A 22 Jul, 2026

Engineer Job Description

For Team Leader Manager

The Bombay Skin Clinic 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Job Title: Team Leader Manager

Lo...
escalation managementteam handlingteam managementteam leadingcommunication skillscustomer services manager

Advocate for Real Estate company
GS Job Point Pvt Ltd 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

llblegal

Vacancy For Customer Services Manager
The Bombay Skin Clinic 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Hiring Customer Service Manager | The Bombay Skin Clinic Location: Lower Parel Employment Type: Full-time Key Responsibilities...
complaint handlingteam handlingpatient relationship managercustomer services managerlead follow-up

Customer Service Engineer
SHM ENTERPRISES 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi 22 Jul, 2026

OurCustomer Servicedepartment is looking for a highly motivated and experienced Customer Service Supervisor to join our team. You will be primarily responsible for handling day-to-day customer se...
social perceptivenesscustomercustomer serviceproblem sensitivitycustomer service managementservicewritten expressionorganizational talentcustomer service orientationoral comprehension

Sr. leak sealing technician
UNInternational Hiring For Sr Leak Sealing Technician 1.00 to 10.00 Years Navi Mumbai, Mumbai CityMumbai City, Shirdi, Bangalore, Kochi, Chennai, Kollam, Mangalore, Mysore, K 22 Jul, 2026

Key Responsibilities

Assist senior technicians and Supervisor in performing online leak sealing operations at client sites.

Support the team...
technicalcommunicationmechanicalverbalenglishbasicwillingnessunderstandingskillswrittennew

Home Loan Sales Manager
Placify Consulting Pvt Ltd Hiring For NoBroker 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

NoBroker Role: Loan Relationship Manager Shift Details: 10:30AM-7:30PM | Mon-Sat working | Sun fix off Work Location: Malad, Kharghar, ...
housing financehome financemortgage loansloan servicinglaphousing counselingloan salescommercial projectshome loans

Wealth Manager B2B
JobStation Enterprise LLP Hiring For Leading Wealth Management 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Hiring Alert | Leading Wealth Management | Mumbai We are hiring B2B Wealth Business and looking for passionate professionals to strengthen our MFD & IFA Channel across Mumbai <...
channel partner managementchannel salesinvestment productsdistributorsmutual fundsifa acquisitionpartner relationship management

Account Executive
Avani Consulting 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Job Description Account Executive Positions

Account Executive Mumbai (Male Only)

Budget: Up to 3.5 LPA (including y...
trial balancetdsmis reportinggstjournal entriestaxationbank reconciliationtally erp

Sales Executive / Relationship Manager Direct Channel
NINA S HR CONSULTANCY Hiring For Kotak Life Insurance 1.00 to 10.00 Years Mumbai City, PunePune, Nagpur 22 Jul, 2026

Relationship Manager / Sales Executive Direct Channel Location: Pune | Mumbai | Nagpur Experience: 6 Months 4 Years (Freshers with good communication skills can also apply) CTC:...
marketingdirect channel salesinsurancedirect salesinsurance salesbusiness developmentdirect selling

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Regional Sales Manager (Wellness & Healthcare)
Global Links 1.00 to 10.00 Years Mumbai City, BangaloreBangalore, Kolkata, Delhi 22 Jul, 2026

Hi Team, We are looking for a dynamic and result-oriented Regional Sales Manager to drive business growth across multiple regions for our wellness and healthcare brand. The ideal candidate will ...
business developmentb2b salesretail salesnutraceuticalschannel salesdistributor managementsales managerhealth supplements

Egocentric AI Data Collection - Apply Only if Iphone with a minimum of model 12.
GUJARAT FACILITY SERVICES Hiring For Egocentric AI Data Collection 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Lucknow, Gurugram, Kolkata, Delhi 22 Jul, 2026

We invite you to collaborate on our AI & Robotics Training Project, which involves recording human tasks from a first-person (egocentric) perspective using head-mounted cameras. This data will he...
data collectionvideo audio image processingiphonework from homedata miningvideo

Back Office Executive- LPO (Legal Process Outsourcing)
Wehire Talent Solutions 1.00 to 10.00 Years Mumbai City, Mira Bhayandar 22 Jul, 2026

Job Description LPO (TLG)| Voice & Non-Voice Process Position

Back Office Executive

Non-Attorney Debt Collector

Paralegal Support...
data entryclient communicationms officenon voice processemail supportlegal process outsourcingdebt collectiondocumentationvoice processofficeexecutive

Head - Supply Chain
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Mumbai City, BhubaneswarBhubaneswar, Bangalore, Hyderabad, Lucknow, Kolkata, Ranchi, Delhi, Bhopal 22 Jul, 2026

Head - Supply Chain Job Profile : The Head of Supply Chain will be responsible for end-to-end supply chain strategy and execution, including procurement, purchasing, contract m...
supply chainwarehouse operationslogistics operationssupply chain operationssourcinglogisticssourcing head

Cost Estimation Engineer
UNInternational Hiring For Yuhan Tech 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Chennai, Hyderabad, Kolkata 22 Jul, 2026

Dear Candidates, Warm greetings from U.N. International! We are pleased to inform you that one of our esteemed clients, Yuhan Tech, has immediate requirements ...
drawingbudgetingproject riskcost savingboqepccost estimationbid submissionoil gas

IT Sales Head
DIGYUG LLP 1.00 to 10.00 Years Mumbai City, Thane 22 Jul, 2026

Interacted with customers to understand business needs and recommend suitable software and IT solutions.

Generated new business th...
salesb2b salesit saleserp salesit product salesproduct demonstrationlead generationsoftware sales

Branch Sales Manager
Acura Solutions 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Roles & Responsibilities:

Mentoring a team of Sales Managers across assigned command area of branches

Identifying leads for an acquisition of potential custo...
salesteam handlingsaving accountcurrent account

HR Executive- Mumbai
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Leading Healthcare company requires HR Executive --Kandiwali( West)-MuMBAI One of our client a leading Healthcare company with the worlds most advanced VELYS Robotic Knee Replacement System,offe...
hr executivehr generalist

Field Trainee
Vimuktaye Solutions 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Hiring Alert Field Trainee (FTC)
We are Hiring for a Global MNC Position: Field Trainee (FTC) Location: Mumbai Qualification:<...
installationfield quality

Customer Service Representative
Smart Employment Services Hiring For BPO 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore 22 Jul, 2026

Graduates and Undergraduate with exp of 1 to 6 years in Customer service in different domains like Banking/ Telecom/ Insurance/ Utilities required No candidates from backend required. Technical...
customer servicevoice processbanking process

Field Officer Sales- (Home Loan)
AASAANJOBS PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, Pune 22 Jul, 2026

Position: Field Officer Sales (FOS) | Home Loan
Department: Retail Assets Home Loan Interview Mode: Virtual Working Days: lead generationfield salesmortgage loansbfsi saleshome loansbanking salesretail assetsdevelop relationshipbuilder channels

Urgent requirement of Operation Executive at Goregaon location
Ultimate Recruiters Hiring For Versetra Tours 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Operations Executive Company : Versetra Tours (Event) Location: Goregaon (East) Experience: 1 to 3 Years CTC: 4 to 5 Lakhs per annum Employment Type: Full-time Job Summary We are looking for a...
operationsoperations managementoperational activities

Financial Planning Consultant
Zecruiters Jobconnect Private Limited Hiring For A Client of Zecruiters Jobconnect Pvt Ltd 1.00 to 10.00 Years Mumbai City, Bangalore 22 Jul, 2026

Description: Purpose:The Financial Planning Analyst will deliver high-quality financial planning, portfolio analysis, and client servicing support for our clients advisory clients. This role focu...
financial advisorywealth advisorywealth managementportfolio analysis

SEO And Automation Manager
PRP Professional Edge Associates Pvt Ltd 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

About the Organization: Moolaah is an independent wealth tech ecosystem to deliver a better financial future to individuals and families with the help of expert advisors. Additi...
google analyticskeyword researchon-page seowebsite auditssemrushahrefai optimizationoff-page seogoogle search console

Chemical Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Qatar, Port Blair, Bangalore, Noida, Chennai, Sri Lanka, United Arab Emirates 22 Jul, 2026

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Sales Associate
INFIFLEX TECHNOLOGIES PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, Thane 22 Jul, 2026

Overview- In this role, you will work hand-in-hand with theSalesteam to introduceCloudProducts and Services to our customers. You will help prospective customers understand the power ofCloudPlatfo...
b2b marketingsales processsalesbdesoftware salesb2b salessoftware industry

Technical Sales Representative
INFIFLEX TECHNOLOGIES PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, Thane 22 Jul, 2026

Overview- In this role, you will work hand-in-hand with theSalesteam to introduceCloudProducts and Services to our customers. You will help prospective customers understand the power ofCloudPlatfo...
salescold callingb2b salesb2b marketingsales processdeal closuredirect salesbusiness developmentbde

AGM Sales Real Estate
Wami Outsourcing Services (OPC) Pvt Ltd 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Dear Candidate, Greetings from Samit HR. We hope you are doing well. We are currently hiring for the position ofAssistant General Manager Real Estate Saleswit...
business developmentresidential salesteam leadershipclient relationship managementsales managementchannel salesreal estate saleschannel partner sales

Administrative Assistant
NEWAGE TECH SOLUTION PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 22 Jul, 2026

Key Responsibilities: - Provide day-to-day administrative and clerical support to senior management and department heads including scheduling, correspondence, and documentation management - Manag...
calendar managementdocumentationtravel coordinationoffice administrationexecutive supportdata entryfilingscheduling

Enterprise sales Associate at Mumbai & Bangalore
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City, Bangalore 22 Jul, 2026

This is aB2B corporate sales role. The candidate must have prior experience incorporate/enterprise salesand should be skilled in selling enterp...
b2b salesenterprise sales

Logistics Specialist-2
Vishwa karma 1.00 to 10.00 Years Mumbai City, Kolkata 22 Jul, 2026

Coordinate transportation and delivery schedules.

Monitor inv...
logistics managementlogisticslogistics operations

Sales Engineer
Ascent Property 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

SALES ENGINEER

Job Position Summary Responsible for generating leads and meeting sales goals.Sales presentations, product promotions and...
factory automationdrivesservoplcs

Executive Assistant
JobFlip 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Position Title: Executive Assistant Experience: 35 years Location: Cuff Parade, Mumbai Reporting To: CEO / MD position - 2 Salary - upto 5LPA Role Summary We are looking for a ...
project managementexecutive managementteam managementsecretarial activitiestravel management

Production Engineer
INTERNATIONAL SPRINGS AND STAMPINGS PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

We are hiring for Production Engineer Location: Plot No. A, 26, Rd Number 10, Wagle Industrial Estate, Thane West, Thane, Maharashtra 400604. Experience: Minimum 3 Years Qualification: B.E. Mec...
automobile engineeringproduction engineering

Office Assistant
Transformer X Consulting Private Limited 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

MIS Executive (Data Entry) The day-to-day duties of an MIS executive revolve around information management and reporting:

data entryexcel sheet

Market Survey Executive
VPERSIST CORPORATE SOLUTIONS PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, BangaloreBangalore, Hyderabad 22 Jul, 2026

Location: Mumbai Salary: 25,000 - 30,000 per month Travel Allowances (Depending on interview performance) Joining Details: Immediate joiner (Must be available to join within 1 week) Job Overv...
field workfield servicesurveying

Business Development Manager in Reputed Finance Company
Bayleaf HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Chennai, Noida, Vizianagaram, Hyderabad, Vishakhapatnam, Gurugram, 22 Jul, 2026

Position Title: Front Line Sales (Business Development Executive/Business Development Manager/Sr. Business Development Manager/Branch Sales Manager/Channel Sales Manager) Minimum 1 Year ...
agency salesbusiness developmentagency developmentagency channel

Loan Officer - Bank Payroll
Global Services 1.00 to 10.00 Years Navi Mumbai, Mumbai CityMumbai City, Thane 22 Jul, 2026

Loan Officer (Home Loan Sales) Bank Payroll Ghansoli (Mahape, Navi Mumbai) We are hiring energetic individuals passionate about sales and achieving aspirational targets. This is a Bank Payroll r...
loan officerstelesalestarget achievementcustomer acquisitionobjection handlinglead managementhome loansbank payrollgraduate fresher

Urgent Hiring in culaba location position of Logistics Executive Assistant
AHS Corporate Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 22 Jul, 2026

Dear Candidate, Greetings! We are pleased to inform you about an exciting job opportunity for the position of *Logistics Executive Assistant* in our organization. Please find the job details b...
chainsupplysupply chain operationslogisticsimportwarehouse operationsinternational

PREV
NEXT

data science techniques digital transformation engineering solutions technology services domain understanding Jobs

data science techniques digital transformation engineering solutions technology services domain understanding Job Openings

Position: Field Officer Sales (FOS) Vehicle Loan

Electrical Supervisor

Engineer Job Description

Job Description

Hiring Alert Field Trainee (FTC)

Position: Field Officer Sales (FOS) | Home Loan

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ... chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation